Strategic Plan Rural Development and Land Reform 2014 - 2019 rural development & land reform Department: Rural Development and Land Reform REPUBLIC OF SOUTH AFRICA Submission of the Strategic Plan of Rural Development and Land Reform for 2014/2019 to the Executive Authority The Honourable GE Nkwinti (MP), Minister of Rural Development and Land Reform Mr PM Shabane $FFRXQWLQJ2I¿FHU RP: 81/2014 ISBN: 978-0-621-42579-6 rural development & land reform Department: Rural Development and Land Reform REPUBLIC OF SOUTH AFRICA Strategic Plan Rural Development and Land Reform 2014 - 2019 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 03 Contents Minister’s foreword 06 $FFRXQWLQJ2I¿FHU¶VRYHUYLHZ 2I¿FLDOVLJQRII Mandate 12 Vision 12 Value statement 12 Values 12 Legislative and other mandates 13 Constitutional Mandates 13 Legislative mandates 13 Relevant court rulings 13 Policy initiatives 13 22 Situational analysis Understanding the department’s external environment 22 Performance environment 22 Organisational Environment 26 Departmental strategic outcome-oriented goals 30 PROGRAMME 1: Administration 'HVFULSWLRQRIWKHVWUDWHJLFSODQQLQJSURFHVV 32 Resource Considerations 33 Risk Management 33 35 PROGRAMME 2: National Geomatics Management Services Resource Considerations 36 Risk Management 36 PROGRAMME 3: Rural Development 39 Resource Considerations 40 Risk Management 40 42 PROGRAMME 4: Restitution Resource Considerations 43 Risk Management 43 PROGRAMME 5: Land Reform 45 Resource Considerations 46 Risk Management 46 49 50 Public entities Public-private partnerships (PPPs) 04 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 List of Acronyms APP Annual Performance Plan AR Annual Report CRDP Comprehensive Rural Development Programme DAC Department of Arts and Culture DAFF Department of Agriculture, Forestry and Fisheries DBE Department of Basic Education DCoG Department of Cooperative Governance DEA Department of Environmental Affairs DHET Department of Higher Education and Training DHS Department of Human Settlements DoH Department of Health DoT Department of Tourism DPME Department of Performance Monitoring and Evaluation DRDLR Department of Rural Development and Land Reform DST Department of Science and Technology dti Department of Trade and Industry DWA Department of Water Affairs ENE Estimates of National Expenditure FET Further Education and Training IAR Immovable Assets Register ICT Information and Communication Technology IT Information Technology ITB Ingonyama Trust Board M&E Monitoring and Evaluation MTEF Medium-term Expenditure Framework MTSF Medium-term Strategic Framework NARYSEC National Rural Youth Service Corps NDP National Development Plan NGP New Growth Path NSDS National Skills Development Strategy NT National Treasury OP Operational Plan PPP Public-private partnership SCOA Standard Chart of Accounts SDF Spatial Development Framework SIP Strategic Infrastructure Project SPLUMA Spatial Planning and Land Use Management Act RADP Recapitalisation and Development Programme RECAP Recapitalisation and Development Programme REID Rural Enterprises and Industrial Development RID Rural Infrastructure Development RIDFF Rural Investment and Development Financing Facility Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 05 Minister’s Foreword “Building vibrant, equitable, and sustainable rural communities” In the commemorative book “30 Years of the Freedom Charter”, it recalls that in consulting people in the rural areas of the country in 1955 as to their demands for inclusion into the resolutions to be considered in respect of the Freedom Charter, WKH¿UVWGHPDQGZDVIRUODQG,QWKHVHDUHDVODQGKXQJHUZDV±DQGWRGD\UHPDLQV ±DPDMRUFKDOOHQJH7KHODQGTXHVWLRQDQGWKHSOLJKWRIWKHGLVSRVVHVVHGUXUDO masses, where they became outcasts in their own country, continues to be a VHQVLWLYHRSHQVRUHRQRXUVRFLHW\ However, despite the systematic disenfranchisement and dispossession, the people of South Africa have always maintained their right to the land as a traditional ELUWKULJKWRIZKLFKWKH\ZHUHUREEHG0D\LEX\HL¶$IULNDLVSUHFLVHO\WKLVGHPDQG and expectation for the restitution of the land to the people and the right to live a SURVSHURXVOLIHLQUXUDO6RXWK$IULFD The Honourable GE Nkwinti (MP) It was furthermore acknowledged that the Natives Land Act, Act number 27 of KDGOHIWODVWLQJVFDUVRQUXUDOFRPPXQLWLHVDSDLQIXOOHJDF\WKDW±DVSDUW RIDGGUHVVLQJWKHQDWLRQDOTXHVWLRQ±KDGWRDQGPXVWEHUHYHUVHG6HFWLRQRIWKH&RQVWLWXWLRQ$FWQXPEHURI 1996) enjoins the State to “take reasonable legislative and other measures, within its available resources, to foster condi- WLRQVZKLFKHQDEOHFLWL]HQVWRJDLQDFFHVVWRODQGRQDQHTXLWDEOHEDVLV´7KLVFRQVWLWXWLRQDOLPSHUDWLYHUHPDLQVDWWKHIRUH- front of the service delivery goals of the Department of Rural Development and Land Reform (DRDLR), as the majority RIRXUFLWL]HQVDUHVWLOOGHSULYHGRIWKLVIXQGDPHQWDOULJKW ,QGLFDWLYHRIRXUFRPPLWPHQWWRDGGUHVVLQJWKLVQDWLRQDOTXHVWLRQWKHSRVW(OHFWLRQ$GPLQLVWUDWLRQOHGE\KLV ([FHOOHQF\ 3UHVLGHQW =XPD HVWDEOLVKHG WKH '5'/5 7KLV HIIHFWLYHO\ LQWURGXFHG WKH GXDO VHUYLFH GHOLYHU\ PDQGDWH RIWKH'5'/5±FRQWLQXLQJZLWKWKHLPSOHPHQWDWLRQRIODQGUHIRUPRQWKHRQHKDQGZKLOVWEHLQJFKDUJHGZLWKWKH massive coordination function of rural development (ensuring that the multiple service delivery streams, including the provision of human settlements, water and sanitation, electricity, healthcare, education, job creation and the like were FRRUGLQDWHGHIIHFWLYHO\DQGHIILFLHQWO\IRUWKHEHQHILWRIDOOUXUDOFRPPXQLWLHV:LWKLQWKLVFRQWH[WWKH'5'/5XQ- YHLOHGLWVDJUDULDQWUDQVIRUPDWLRQVWUDWHJ\VXSSRUWHGE\WKH&RPSUHKHQVLYH5XUDO'HYHORSPHQW3URJUDPPH&5'3 Furthermore, government has set the National Development Plan (NDP) as its development framework and the New *URZWK3DWKDVLWVVWUDWHJ\$VVXFKDOOSROLFLHVDQGVWUDWHJLHVRIWKH'5'/5KDYHEHHQDOLJQHGWRERWKLQWHUPVRI WKH±0HGLXP7HUP6WUDWHJLF)UDPHZRUN076)7KLVDOLJQPHQWKDVIXUWKHUPRUHEHHQHQVXUHGWKURXJK a comprehensive process of legislative, policy, institutional and implementation reforms, currently at various stages of FRPSOHWLRQXQGHUWDNHQE\WKH'5'/5 At the core of this mandate is land restitution, which has been the main driver behind addressing the national grievence RIODQGGLVSRVVHVVLRQDVDUHVXOWRIWKH1DWLYHV/DQG$FW:LWKLQWKLVFRQWH[WWKH'5'/5KDVLQWHUPVRILQVWLWX- WLRQDOUHIRUPVDQGWUDQVIRUPDWLRQXQGHUWDNHQDQH[HUFLVHRILQVWLWXWLRQDOSROLF\DQGOHJLVODWLYHUHIRUPV±LQWKLVUHJDUG the Restitution of Land Rights Amendment Bill, reopening the land claims process and which effectively propels us IRUZDUGLQRXUTXHVWWRUHYHUVHWKHOHJDF\RIWKH/DQG$FWZDVSDVVHGE\WKLV+RXVHRQ)HEUXDU\7KLV historic event builds on other legislative achievements of the department in respect of land reform, including the pass- ing of the Spatial Planning and Land Use Management Act, the Deeds Registration Amendment Act, the Sectional Titles $PHQGPHQW$FWDQGWKH*HRPDWLFV3URIHVVLRQ$FW$YDVWDUUD\RISROLFLHVKDYHDOVREHHQFRPSOHWHGDQGZLOOLQIRUP RXUVHUYLFHGHOLYHU\DFWLYLWLHV We are also making progress with the promise we made in 2010 to bring into full production land reform farms lying idle after they have been handed over to their new owners by introducing the Recapitalization and Development Programme 5$'3ZKLFKKDVVHHQWKHVHQHZODQGRZQHUVEHLQJJLYHQWHFKQLFDODQGPDWHULDOVXSSRUWIRU¿YH\HDUVXQWLOWKH\FDQ VWDQGRQWKHLURZQ 06 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 ,QWHUPVRIRXURQJRLQJFRPPLWPHQWWR\RXWKGHYHORSPHQWDVDW'HFHPEHUSDUWLFLSDQWVIURPDOO3URYLQFHV ZHUHEHQH¿WWLQJIURPWKH1$5<6(&SURJUDPPH,QWHUPVRIWKH$1&¶V(OHFWLRQ0DQLIHVWRLWLVHQYLVDJHGWKDW WKLVQXPEHUZLOOEHLQFUHDVHGWRRYHUWKHQH[W¿YH\HDUVLPSDFWLQJSRVLWLYHO\RQWKHGHYHORSPHQWRIRXUFRXQWU\ LQJHQHUDODQGRXUUXUDODUHDVLQSDUWLFXODUWKURXJKWKHJHQHUDWLRQRIHPSRZHUHG\RXWK±WKHOHDGHUVDQGGULYHUVRI RXUFRXQWU\¶VIXWXUH ,QOLQHZLWKWKHSULQFLSOHVRI³HTXLWDEOHDFFHVVWRODQGDFURVVUDFHJHQGHUDQGFODVV´JRYHUQPHQWZLOOFRQWLQXHVXSSRUWLQJ YDULRXVEHQH¿FLDULHVLQFOXGLQJHPHUJLQJEODFNFRPPHUFLDOIDUPHUVFRPPXQLWLHVLQFRPPXQDORZQHUVKLSIDUPZRUNHUV FRRSHUDWLYHVDQGODERXUWHQDQWV ,QRXUHQGHDYRUVWRFKDQJHWKHOLYHVRIRXUSHRSOHZHZLOOZRUNLQSDUWQHUVKLSZLWKDOOUROHSOD\HUVDQGVWDNHKROGHUV )RUWKH¿UVWWLPHLQWKHKLVWRU\RIWKLVGHSDUWPHQWZHKDYHREWDLQHGDQXQTXDOL¿HGDXGLWLQWKHSDVW¿QDQFLDO\HDU:H will continue to build on this achievement and have put in place systems and processes to maintain this momentum and, LQWRWKHIXWXUHLPSURYHWKHUHRQ The effects of centuries of plunder, dispossession and marginalisation will not, and cannot be eradicated at a click of a EXWWRQWKHKDQJRYHUZLOOEHZLWKXV\HWIRUDORQJWLPH±EXWWKLVGRHVQRWPHDQWKDWZHKDYHWRVLWEDFNDQGDFFHSWWKH VLWXDWLRQ2XUDFWLRQVRYHUWKHSDVW\HDUVKDYHVRXJKWWRV\VWHPDWLFDOO\DGGUHVVWKHVHFKDOOHQJHV:HDUHJDLQLQJ PRPHQWXPZLWKHYHU\SDVVLQJ\HDUZLWKHYHU\QHZSROLF\ZLWKHYHU\SLHFHRIOHJLVODWLRQSURPXOJDWHG%HDVVXUHGRI our commitment and intentions to revitalise our rural communities so that they too can experience and reap the rewards RIRXUORQJDQGKDUGIRXJKWVWUXJJOHIRUDGHPRFUDWLFIXWXUH±7RJHWKHU:H0RYH6RXWK$IULFD)RUZDUG The Honourable Nkwinti, GE (MP) Minister: Rural Development and Land Reform Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 07 $FFRXQWLQJ2I¿FHU¶V2YHUYLHZ Government’s Programme of Action (PoA) under the current administration prioritised amongst other things rural development, including land reform, food production DQGIRRGVHFXULW\7RJLYHHIIHFWWRWKHUXUDOGHYHORSPHQWDQGODQGUHIRUPPDQ- date, the Department of Rural Development and Land Reform was established in 7KHGHSDUWPHQWZDVDOVRWDVNHGZLWKWKHFRRUGLQDWLRQRIJRYHUQPHQWZLGH interventions aimed at bringing about the results championed in the Outcome 7 'HOLYHU\$JUHHPHQW ,QSXUVXLWRISURYLGLQJDQDGHTXDWHUHVSRQVHWRWKHQHZUXUDOGHYHORSPHQWDQG land reform mandate, the Department of Rural Development and Land Reform, under the guidance of the Minister, engaged in a rigorous process of policy and legislation development and organising itself into a well-established institution with proper systems, well-engineered business processes and institutional arrange- PHQWVWRGHOLYHULQDFFRUGDQFHZLWKWKHH[SHFWDWLRQVRIJRYHUQPHQW Mr PM Shabane One of the critical policy interventions institutionalised by the department during this term was the development of the Comprehensive Rural Development Pro- gramme (CRDP) that coordinates efforts geared towards improving the livelihoods RISHRSOHOLYLQJLQUXUDODUHDVDQGJUHDWHUIRFXVRQDODQGUHIRUPGLVSHQVDWLRQWKDWFHQWUHVHTXLW\GHYHORSPHQWDJUDULDQ WUDQVIRUPDWLRQDQGIRRGVHFXULW\DWWKHFRUHRIDOOLQWHUYHQWLRQV6LJQL¿FDQWDQGFRPPHQGDEOHVWULGHVZHUHPDGHRYHU WKHODVW¿YH\HDUVLQFOXGLQJLQFUHDVHGDFFHVVWREDVLFVHUYLFHVE\SHRSOHUHVLGLQJLQUXUDODUHDVVSHFWDFXODUSURJUHVVLQ the delivery of socio-economic infrastructure in deep rural areas thus enabling linkages to other socio-economic oppor- WXQLWLHVSURYLVLRQRIUXUDOHQWHUSULVHVXSSRUWWRLPSURYHUXUDOOLYHOLKRRGV¿QDOLVDWLRQRIWKHVWDWHODQGDXGLWWRHQKDQFH DFFRXQWDELOLW\LQWKHPDQDJHPHQWRIODQGIRUEHWWHUSODQQLQJDQGGHYHORSPHQWVXSSRUWLQJODQGUHIRUPEHQH¿FLDULHVWR LPSURYHWKHSURGXFWLYLW\RIWKHLUIDUPLQJHQWHUSULVHVSURPRWLQJWHQXUHVHFXULW\DQGDFTXLVLWLRQDQGUHGLVWULEXWLRQRIODQG WRLPSURYHHTXLW\LQODQGRZQHUVKLSDQGPDNLQJVLJQL¿FDQWFRQWULEXWLRQLQUHGXFLQJUXUDOKRXVHKROGIRRGLQVHFXULW\ 'HVSLWHWKHVLJQL¿FDQWO\REVHUYDEOHSURJUHVVPDGHLQWKH¿UVWWHUPRIWKHHVWDEOLVKPHQWRIWKHGHSDUWPHQWWKHUHDUH FKDOOHQJHVWKDWKLQGHUWKHEHVWHIIRUWVRIWKHGHSDUWPHQW7KHOHVVRQVOHDUQWRYHUWKHSDVW¿YH\HDUVKDYHKRZHYHUEHHQ used to develop a more focused Medium Term Strategic Framework 2014-2019 (MTSF 2014-2019) that is properly DOLJQHGWRWKH1DWLRQDO'HYHORSPHQW3ODQ1'37KLVDOLJQPHQWZDVWUDQVODWHGLQWRWKHGHYHORSPHQWRIWKH 6WUDWHJLF3ODQRIWKHGHSDUWPHQW The main thrust of the department’s 2014-2019 Strategic Plan is to implement appropriate policy and programme interventions which respond to the immediate needs of rural residents and rural communities whilst engaging in policy research and development that explores longer-term strategies to address the systemic deprivation of rural residents DQGWKXVFRQWULEXWHWRZDUGVWKHUHGXFWLRQRISRYHUW\DQGLQHTXDOLW\ 7KHUHIRUHWKHPDLQIRFXVRIWKHGHSDUWPHQWRYHUWKHQH[W¿YH\HDUVLVWRPD[LPLVHGHYHORSPHQWEHQH¿WVE\VWUHQJWK- HQLQJFRRSHUDWLRQDQGFRRUGLQDWLRQHIIRUWVZLWKVLJQL¿FDQWDWWHQWLRQSODFHGRQLVVXHVVXFKDVLPSURYLQJLQVWLWXWLRQDO DUUDQJHPHQWV IRU FRRUGLQDWHG GHYHORSPHQW SODQQLQJ DQG LPSOHPHQWDWLRQ DPRQJVW YDULRXV SOD\HUV7KLV LV DLPHG DW PDNLQJGHYHORSPHQWEHQH¿WVUHDFKWKHPDUJLQDOLVHGWKURXJKVKDUHGUHVRXUFHSODQQLQJDQGXWLOLVDWLRQIRUZHOOWDUJHWHG GHYHORSPHQWUHVXOWV This will be achieved through the implementation of tailored interventions such as effective systems of land admin- istration and management, as well as building institutions that will support the achievement of better results of the SURJUDPPHVRIWKHGHSDUWPHQWDQGJRYHUQPHQW7KHWDUJHWHGLQWHUYHQWLRQVDOVRLQFOXGHDIRFXVRQLPSURYLQJJRYHUQ- DQFHLQWKHIRUPRIDFFRXQWDELOLW\WUDQVSDUHQF\DQGUHVSRQVLYHQHVVVWUDWHJLFODQGDFTXLVLWLRQVIRFXVLQJRQODQGWKDW is productive in order to ensure that state investment achieves the desired socio-economic development results;; and JUHDWHUHPSKDVLVRQWKHUHFDSLWDOLVDWLRQDQGGHYHORSPHQWRIDFTXLUHGDJULFXOWXUDOODQGWKHUHE\LPSURYLQJSURGXFWLYLW\ 08 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Furthermore, other prioritised interventions for implementation include skills development biased towards rural residents particularly the youth and the creation of rural industries to support job creation while also developing industry related VNLOOV7KHGHSDUWPHQWZLOODOVRHQVXUHWKDWDGHTXDWHVXSSRUWLVJLYHQWRPXQLFLSDOLWLHVWRLPSOHPHQWWKH6SDWLDO3ODQQLQJ DQG/DQG8VH0DQDJHPHQW$FW63/80$$FW1RRILQRUGHUWRLPSURYHVSDWLDOSODQQLQJDQGGHYHORS- PHQW7KLVLVDLPHGSULPDULO\DWLPSURYLQJUXUDOXUEDQOLQNDJHVLQRUGHUWRSURPRWHPDUNHWDFFHVVIRUUXUDOHQWHUSULVHV DQGLQGXVWULHVLQWKHORQJWHUP I believe that with the continued guidance and leadership of the Minister and the Deputy Minister, together with the commitment and capabilities of the management and staff of the department, the interventions outlined in this strategic SODQZLOODFKLHYHWKHGHVLUHGUHVXOWV PM Shabane Director-General: Rural Development and Land Reform Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 09 2I¿FLDO6LJQ2II ,WLVKHUHE\FHUWL¿HGWKDWWKLV6WUDWHJLF3ODQ was developed by the management of the Department of Rural Development and Land Reform under the guidance of Minister Nkwinti, GE (MP);; takes into account all the relevant policies, legislation and other mandates for which the Department of Rural Development and Land Reform is responsible;; and DFFXUDWHO\UHÀHFWVWKHVWUDWHJLFRXWFRPHRULHQWHGJRDOVDQGREMHFWLYHVWKH'HSDUWPHQWRI5XUDO'HYHORSPHQWDQG Land Reform will endeavour to achieve over the period 2014 to 2019. Mr T Motsoeneng $FWLQJ&KLHI)LQDQFLDO2I¿FHU Signature: ___________________________ Mr PG Sekawana (Acting) Deputy Director-General: Corporate Support Services Signature: ___________________________ Mr PM Shabane $FFRXQWLQJ2I¿FHU Signature: ___________________________ Signature: ___________________________ Approved by: The Honourable Nkwinti, GE (MP) Executive Authority 10 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 3$57$6WUDWHJLF2YHUYLHZ Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 11 Mandate 7RFUHDWHDQGPDLQWDLQDQHTXLWDEOHDQGVXVWDLQDEOHODQGGLVSHQVDWLRQDQGDFWDVDFRRUGLQDWRUDQGFDWDO\VWLQUXUDO development to ensure sustainable rural livelihoods, decent work and continued social and economic advancement for DOO6RXWK$IULFDQV Vision 9LEUDQWHTXLWDEOHVXVWDLQDEOHUXUDOFRPPXQLWLHV Mission 7RLQLWLDWHIDFLOLWDWHFRRUGLQDWHFDWDO\VHDQGLPSOHPHQWDQLQWHJUDWHGUXUDOGHYHORSPHQWSURJUDPPH Value Statement :HXSKROGWKHIROORZLQJYDOXHV :HYDOXHDQGHQFRXUDJHGLYHUVLW\DQGZLOOQRWGLVFULPLQDWHDJDLQVWDQ\RQH $VDUHVSRQVLEOHJRYHUQPHQWGHSDUWPHQWZHVKDOOVWULYHWREHtransparent, accountable and UHVSRQVLYH :HVKDOOHQVXUHWKDWZHKDYHDGHGLFDWHGOR\DOUHVXOWVRULHQWHGSURIHVVLRQDODQGSHRSOHIRFXVHG ZRUNIRUFH ,QFROODERUDWLRQZLWKDOOVWDNHKROGHUVWKHGHSDUWPHQWZLOOcomply with all lawsRIWKLVFRXQWU\ Values Integrity Diversity Transparency Diligence Compassion Accountability Professionalism People focused 12 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Honesty /HJLVODWLYHDQGRWKHU0DQGDWHV Constitutional Mandates Constitution of the Republic of South Africa, 1996 (Act No. 108 of 1996) 7KHPDQGDWHRIWKHGHSDUWPHQWLVGHULYHGIURPVHFWLRQVDQGRIWKH&RQVWLWXWLRQ6HFWLRQSURSHUW\FODXVH establishes the framework for the implementation of land reform, and sections 24 (environment clause) and 27 (health FDUHIRRGZDWHUDQGVRFLDOVHFXULW\FODXVHHVWDEOLVKWKHIUDPHZRUNIRUWKHLPSOHPHQWDWLRQRIWKH&5'3 3ROLF\LQLWLDWLYHV 7KHGHSDUWPHQWKDVPDGHVLJQL¿FDQWSURJUHVVLQSROLF\GHYHORSPHQWVLQFHWKHDGRSWLRQRIWKH&5'3LQDQGWKH *UHHQ3DSHURQ/DQG5HIRUPLQ$XJXVWE\&DELQHW7KHSLORWLQJRIWKH&5'3WRJHWKHUZLWKH[WHQVLYHFRQVXOWD- tions on the Green Paper on Land Reform, has resulted in the development and approval of a range of policies in August 'XULQJWKH±SHULRGWKHGHSDUWPHQWZLOOFRQWLQXHZRUNLQJRQVRPHRIWKHVHSROLFLHVDQGDOVRLQLWLDWHRWKHUVLQ RUGHUWRH[HFXWHLWVPDQGDWH The Minister has internally approved some policies for internal operational guidance and framing and policies that will SURFHHGWRZDUGVOHJLVODWLRQ6RPHRIWKHSROLFLHVZLOOSURFHHGWRWKHQHZ&DELQHWDIWHUWKHJHQHUDOHOHFWLRQV The goal of the rural development and land reform policy is to stimulate rural revitalization, rural employment, social FRKHVLRQSURVSHULW\IXOOHPSOR\PHQWVKDUHGJURZWKDQGUHODWLYHLQFRPHHTXDOLW\ The strategic thrust, also set out in the Green Paper, is that land reform should be pursued with minimal disruption to IRRGSURGXFWLRQ 7KHGHSDUWPHQWKDVGH¿QHGODQGUHIRUPWREHLQFOXVLYHRIWKHIROORZLQJIRXUIXQFWLRQVRUSLOODUV LUHVWLWXWLRQRIODQGULJKWV LLUHGLVWULEXWLRQRIODQG LLLODQGWHQXUHUHIRUPDQG LYGHYHORSPHQWRIWKHODQG 7KHSULQFLSOHVXQGHUSLQQLQJODQGUHIRUPDUHWKUHHIROG L'HUDFLDOLVDWLRQRIWKHUXUDOHFRQRP\ LL'HPRFUDWLFDQGHTXLWDEOHODQGDOORFDWLRQDQGXVHDFURVVJHQGHUUDFHDQGFODVVDQG LLL6WULFWSURGXFWLRQGLVFLSOHIRUJXDUDQWHHGQDWLRQDOIRRGVHFXULW\ Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 13 With this understanding, the rationale of the individual policy reforms can be framed as follows: Policy Trajectory SCALE-UP LAND ACCESS Policies 6WUDWHJLF2EMHFWLYHV State Asset Lease and Disposal Policy To provide for a coherent policy for the department leases on department owned agricultural land and other state properties administered by the department and disposal in line with the Government Immovable Asset Management Act Re-Opening of Restitution Address the land needs of those who could QRWPHHWWKH'HFHPEHUFXWRIIGDWH IRUORGJPHQWRIFODLPV Exceptions to 1913 cut-off date Address the land plight of decedents of the Khoi & the San General recognition of Heritage sites and KLVWRULFDOODQGPDUNV (VWDEOLVKDQ2I¿FHRIWKH9DOXHU*HQHUDOWKURXJK3URSHUW\ Valuations Bill ,QWURGXFHMXVWDQGHTXLWDEOH FRPSHQVDWLRQ Effectively pay lesser for land than in the past and make more resources available to DFFHVVPRUHODQG Provide valuations in support to offers to SXUFKDVHDQGH[SURSULDWLRQ Address disputes over compensation RIIHUHG Agricultural Land Holdings Policy Framework Introduce upper and lower limits to DJULFXOWXUDOODQGKROGLQJVL]HV (PSOR\VFLHQWL¿FDQGSDUWLFLSDWRU\ GHWHUPLQDWLRQVWRVL]HV Disincentive to land hording and VSHFXODWLRQ Promote productive and sustainable XVHRIODQG 14 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Policy Trajectory ENHANCE LAND DEVELOPMENT THROUGH TENURE REFORM Policies Land Tenure Security Policy for Commercial Farmers 6WUDWHJLF2EMHFWLYHV Address tenure insecurity of farm dwellers, IDUPZRUNHUVDQGWKHLUIDPLOLHV Establish a Land Rights Management Board and local Land Rights Manage- ment Committees to address land tenure insecurity and development in commercial IDUPLQJDUHDV $YHUWLOOHJDOHYLFWLRQV Promote on-and-off commercial farm settlements and access to productive commercial farm land Determine certainty in land rights and DFFHVVHVIRUSURGXFWLYHXVH Anchor the programme on and a rights awareness (communications and education SURJUDPPH Policy on Land Ownership by Foreign Nationals Regulate land ownership by foreign nation- DOVDQGEXVLQHVVHQWLWLHV Ensure priority access to land by South African citizens;; Promote long term leases for foreign nationals;; Also place limits on land sizes to foreign nationals in terms of the “Agricultural Land Holdings Policy Framework” addressed DERYH 0DNHPRUHODQGDYDLODEOHIRUODQGUHIRUP Promote policy certainty and FRQVHTXHQWO\FUHDWHDQHQDEOLQJSROLF\ HQYLURQPHQWIRULQWHUQDWLRQDOLQYHVWPHQW Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 15 Policy Trajectory Policies Land Commission 6WUDWHJLF2EMHFWLYHV To address double registrations and associated land disputes in land held under the custodianship of the Department of 5XUDO'HYHORSPHQWDQG/DQG5HIRUP To determine rightful rights to land in cases RIGLVSXWHV To make land accessible to development E\GHWHUPLQLQJWHQXUHULJKWV SUPPORT PRODUCTIVE USE OF LAND Rural Development Policy Framework Build on four years of piloting the Comprehensive Rural Development IUDPHZRUN %XLOGRQKRXVHKROGFDSDELOLWLHV Promote social and economic LQIUDVWUXFWXUH Deploy resources of the Animal and Veld Management, River Catalytic, Enterprise Development and Industry 'HYHORSPHQWSURJUDPPHV Promote youth active involvement in GHYHORSPHQW Promote clear rights in land;; Incentivise development through a Rural Investment and Development Finance )DFLOLW\ Coordinate development through a rural GHYHORSPHQWDJHQF\ Recapitalisation and Development Policy Recapitalise farm projects that were challenged as a result of constrained EHQH¿FLDU\DQGSURMHFWVXSSRUW Promote project development and SURGXFWLYLW\ Support the Animal and Veld 0DQDJHPHQWDQG5LYHU&DWDO\WLF3URMHFWV Incentivise partnerships for 'HYHORSPHQW 16 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Policy Trajectory Policies 6WUDWHJLF2EMHFWLYHV Rural Development Agency and Investment and Development Finance Facility An agency to support the management and facilitation of rural development Incentivize partnerships for rural GHYHORSPHQW Leverage resources for rural development The table below outlines the status of policies: $OO$SSURYHG3ROLFLHV Policy DSSURYHG by Minister Policies Prioritized for Legislation 2I¿FHRIWKH9DOXHU General Property Valuations Bill Land Tenure Policy for Commercial Farming Areas Extension of Security of Tenure Act Amendment Bill Land Management Commission Land Management Commission Bill Policies to Cabinet for Public Comments Legislation Targeted for After the 2014 Election State Assets $FTXLVLWLRQDQG/HDVH Disposal Policy Agricultural Land Holdings Policy Framework Policy on Land Ownership by Foreign Nationals Including the ³$FTXLVLWLRQVDQG Disposal of Land by foreign Persons Bill” Communal Land Tenure Policy Including a “Communal Land Tenure Bill” Communal Property Association Policy (CPAs) Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 17 Policy DSSURYHG by Minister $OO$SSURYHG3ROLFLHV Policies Prioritized for Legislation Policies to Cabinet for Public Comments Legislation Targeted for After the 2014 Election Rural Development Framework Restitution Policy 5HRSHQLQJRI'HF Cutoff date) Restitution of Land Rights Act Amendment Bill: 2013 Restitution Re-Opening (Pre-1913) Recapitalisation and Development Policy Rural Development Agency Policy Rural Investment and Development Financing Facility /HJLVODWLYH0DQGDWHV The following are some of the legislation from which the department derives its mandate: Acts Strategic Focus Land Reform: 3URYLVLRQRI/DQG and Assistance Act, $FW1RRI 1993) 7KHDFWUHTXLUHVWKDWWKHGHSDUWPHQWSURYLGHVIRUWKHGHVLJQDWLRQRIFHUWDLQODQGWKHUHJXODWLRQRIWKHVXEGLYLVLRQ RIVXFKODQGDQGWKHVHWWOHPHQWRISHUVRQVRQLW,QDGGLWLRQLWSURYLGHVIRUWKHDFTXLVLWLRQPDLQWHQDQFHSODQQLQJ GHYHORSPHQWLPSURYHPHQWDQGGLVSRVDORISURSHUW\DQGWKHSURYLVLRQRI¿QDQFLDODVVLVWDQFHIRUODQGUHIRUP SXUSRVHV Land Reform (Labour Tenants) $FW$FW1R of 1996): The act makes provision for the security of tenure of labour tenants and those persons occupying or using land DVDUHVXOWRIWKHLUDVVRFLDWLRQZLWKODERXUWHQDQWV,WDOVRPDNHVSURYLVLRQIRUWKHDFTXLVLWLRQRIODQGDQGULJKWVLQ ODQGE\ODERXUWHQDQWV /DQG6XUYH\$FW $FW1RRI 1997) 7KHDFWUHJXODWHVWKHVXUYH\RIODQGLQWKH5HSXEOLFRI6RXWK$IULFD7KHOHJLVODWLRQSURYLGHVIRUPDQDJHPHQWRI cadastral surveys and land information services, geodetic and topographical surveying and geospatial information services in the country Spatial Data Infrastructure Act, $FW1RRI 2003) The act provides for the establishment of the South African Spatial Data Infrastructure (SASDI) in order to regu- ODWHWKHFROOHFWLRQPDQDJHPHQWPDLQWHQDQFHLQWHJUDWLRQGLVWULEXWLRQDQGXVHRIVSDWLDOLQIRUPDWLRQ7KHDFWDOVR SURPRWHVWKHHI¿FLHQWDQGHIIHFWLYHXVHRIWKH6WDWH¶VVSDWLDOLQIRUPDWLRQUHVRXUFHVE\VKDULQJRIWKHLQIRUPDWLRQ Deeds Registries $FW$FW1R of 1937): 7KHDFWPDNHVSURYLVLRQIRUWKHDGPLQLVWUDWLRQRIWKHODQGUHJLVWUDWLRQV\VWHPDQGWKHUHJLVWUDWLRQRIULJKWVLQODQG 7KURXJKWKH2I¿FHRIWKH&KLHI5HJLVWUDURI'HHGVWKHGHSDUWPHQWLVPDQGDWHGWRUHJLVWHUWLWOHGHHGVIRUHYHU\ SURSHUW\UHJLVWUDWLRQORGJHG 18 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 The following legislative development programme for the last 5 years, has been meant to fully TRANSFORM the land ownership and control of the South African land trajectory to derive the ultimate goal of correcting the past land owner- VKLSSUDFWLFHVDVDUHVXOWRIWKH1DWLYH/DQG$FW The following laws have been passed by parliament during the term of the current administration: Strategic Focus Status SPATIAL PLANNING AND LAND USE MANAGEMENT ACT, ACT 16 OF 2013 The implementation of the Bill will provide critical support to a number of noble objectives of the government, especially;; 7KH+XPDQ6HWWOHPHQWSURJUDPPHV 7KHHFRQRPLFSURJUDPPHVVLQFHWKHODQGGHYHORSPHQW planning and approval system impedes investment and fails to HVWDEOLVKVXI¿FLHQWFHUWDLQW\LQWKHODQGPDUNHWDQG 6SDWLDOSURJUDPPHVWRDGUHVVVHJUHJDWLRQDQGXQHTXDOVSDWLDO patterns Assented to on 2 August by the Presi- GHQWDQGJD]HWWHGRQ$XJXVW 1RZ63/80$$FWRI GEOMATICS PROFESSIONS ACT, ACT 19 OF 2013 The Bill intends to replace the Professional and Technical 6XUYH\RUV$FWRIZKLFKFDWHUHGIRUVXUYH\RUVEXW H[FOXGHGJHRJUDSKLFDOVFLHQFHSURIHVVLRQDOVDQGPLQHVXUYH\RUV The Bills seeks to make provision for all geomatics professionals, WHFKQRORJLVWVDQGWHFKQLFLDQV,WIXUWKHUPRUHZLOOHQVXUHWKDWWKH The Bill was assented to and signed into law on the 10th of December 2013 and is now the Geomatics Professions Act, $FWRI Acts professional council is more representative, while it places more emphasis on education and training, as well as the marketing of the SURIHVVLRQWRDWWUDFWPRUHSHRSOHWRWKHSURIHVVLRQ SECTIONAL TITLES AMENDMENT ACT, ACT 33 OF 2013 7KHDPHQGPHQWWR6HFWLRQDO7LWOHV$FWWRDPHQGFHUWDLQGH¿QL- tions;; to provide for the electronic delivery of notices for purposes of general meetings of a body corporate;; to provide for the HQGRUVHPHQWRIUHJLVWHUHGPRUWJDJHERQGVDJDLQVWFHUWL¿FDWHVRI registered sectional title issued in terms of section 15B(5A) of the Act;; WRSURYLGHIRUWKHORGJHPHQWRIDFOHDUDQFHFHUWL¿FDWHZLWKWKHUHJLVWUD- tion of a cession of real rights to further provide for the consent by owners and holders of a right of extension to the alienation of common property;; to further provide for the consent of The Deeds Registries Act, 1937, is to be amended to substitute an obsolete reference;; to provide for the substitution of certain headings to sections;; to provide for the amendment of certain references to provinces;; and to amend WKHGH¿QLWLRQRI³GHHGVUHJLVWU\ Bill assented to and signed into law on the 14th of December 2013 and is now the Sectional Titles Amendment Act, Act RI DEEDS REGISTRIES AMENDMENT ACT, ACT 34 OF 2013 The Deeds Registries Act, 1937, is to be amended to substitute an obsolete reference;; to provide for the substitution of certain headings to sections;; to provide for the amendment of certain UHIHUHQFHVWRSURYLQFHVDQGWRDPHQGWKHGH¿QLWLRQRI³GHHGVUHJLVWU\ The Bill was assented to and signed into law on the 14th of December 2013 and is now the Deed Registries Amendment $FW$FWRI Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 19 Bills being processed and are therefore work in progress Bill Strategic focus Status RESTITUTION OF LAND RIGHTS AMENDMENT BILL, 2013 The purpose of the Bill is to provide for the re-opening of lodgement The Bill was passed by the National of land claims by persons or communities dispossessed of rights in Assembly and is now being considered by land as a result of past racially discriminatory laws and practices, to WKH1&23 provide for permanent judges to sit at the land claims court and to SURYLGHIRUPDWWHUVFRQQHFWHGWKHUHZLWK PROPERTY VALUATION BILL, 2013 The purpose of the Bill is to give effect to the provisions of the Con- stitution which provide for land reform and to facilitate land reform WKURXJKWKHUHJXODWLRQRIWKHYDOXDWLRQRISURSHUW\7KH%LOOPDNHV SURYLVLRQIRUWKHHVWDEOLVKPHQWRID9DOXHU*HQHUDO¶V2I¿FHZKLFK ZLOOSURYLGHDYDOXDWLRQVHUYLFHIRUSURSHUW\WKDWKDVEHHQLGHQWL¿HG for expropriation and land reform purposes, as well as voluntary SURSHUW\YDOXDWLRQVHUYLFHWRGHSDUWPHQWVWKDWPD\UHTXHVWWKH RI¿FHWRSHUIRUPVXFKYDOXDWLRQV7KHRI¿FHRIWKH9DOXHU*HQHUDO will also serve a regulatory function which will provide for the setting of criteria, procedures and the monitoring of valuations SHUIRUPHGLQWKHDERYHUHVSHFW The Bill will be debated on by the National $VVHPEO\RQWKHWKRI0DUFK LAND PROTECTION BILL, 2013 This Bill seeks to foster conditions that ensure improved access to land for citizens;; Create conditions that would enable South African ODQGDQGODQGHGDVVHWVWREHXWLOL]HGIRUWKHJUHDWHUEHQH¿WRILWV citizens and residents;; Foster increased access of South African Land and landed assets by its citizens and residents;; Create a policy and regulatory environment which ensures that the value of sensitive South African land and landed assets is recognized, pro- tected and enhanced by non-national and/or non- resident;; Provide a transparent and more conducive regulatory environment for the JHQHUDWLRQDQGXWLOL]DWLRQRISROLF\±UHOHYDQWLQIRUPDWLRQRQODQG ownership and usage, thereby improving the state’s ability to monitor and evaluate its compliance with the Constitutional GLUHFWLYHWRHQVXUHODQGWHQXUHDQGUHODWHGUHIRUPV 3ROLF\UHYLVHGDQGDSSURYHG'UDIWKDV commenced and there’s ongoing GLVFXVVLRQZLWKOLQHIXQFWLRQDULHV LAND COMMISSION BILL, 2013 The purpose of this Bill is to establish a Land Commission (LC), to address institutional weaknesses in land management policy, land DGPLQLVWUDWLRQDQGWKHIUDJPHQWHGODQGOHJLVODWLRQ)RUWKLVSXU- pose, the LC will amongst others have an advisory role in respect of policy formulation and development, as well as a co-ordinating role in respect of the execution of land management functions by FHUWDLQODQGFXVWRGLDQV Bill approved by Cabinet on 11 September 2013 for publication for public comment for GD\V7KHSHULRGRIGD\VH[SLUHGRQ WKHWKRI2FWREHUDQGWKHWHDPLVLQ the process of consolidating and consider- ing the comments after which a report will EHURXWHGWRWKH0LQLVWHU7KH¿UVWGUDIWRI WKH5,$LVEHLQJFRQVLGHUHG COMMUNAL PROPERTY ASSOCIATIONS AMENDMENT BILL, 2013 It is intended to amend the Communal Property Associations Act, VRDVWRUHGH¿QHWKHNLQGRIFRPPXQLWLHVDQGSHUVRQVWR ZKRPWKHSURYLVLRQVRIWKH$FWDSSO\,WLVIXUWKHULQWHQGHGWR FOHDUO\GH¿QHWKHQDWXUHDQGVXEVWDQFHRIWKHUHSRUWRQFRPPXQDO SURSHUW\DVVRFLDWLRQVWKDWKDVWREHWDEOHGLQ3DUOLDPHQW The Bill will be submitted through the DG clusters and will be submitted to Cabinet &RPPLWWHHZLWKWKHQHZDGPLQLVWUDWLRQ EXTENSION OF SECURITY OF TENURE AMENDMENT BILL, 2013 The proposed amendments are derived from the wider draft policy RQ/DQG7HQXUH6HFXULW\LQUHVSHFWWRFRPPHUFLDO)DUPLQJDUHDV 7KH%LOODLPVWR¿QGODVWLQJVROXWLRQVWRWHQXUHLQVHFXULWLHVLQWKHVH areas through combining land redistribution measures within HIIHFWLYHOHJDOSURWHFWLRQDQGGLVSXWHPHFKDQLVPV The Bill is currently going through the NEDLAC proces 20 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Other Mandates Proposed Institutions The department has over the last few years conceptualized the new institutional arrangements in support of the new SROLF\WUDMHFWRU\ The following bills once approved by parliament will enable the department to establish the following institutions: /DQG&RPPLVVLRQ/&/DQG&RPPLVVLRQ%LOO /DQG5LJKWV0DQDJHPHQW%RDUG/50%([WHQVLRQRI6HFXULW\RI7HQXUH$PHQGPHQW%LOO 2I¿FHRIWKH9DOXHU*HQHUDO29*3URSHUW\9DOXDWLRQ%LOO Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 21 Situational Analysis 8QGHUVWDQGLQJWKHGHSDUWPHQW¶V([WHUQDO(QYLURQPHQW $KRUL]RQVFDQQLQJHQYLURQPHQWDOVFDQQLQJH[HUFLVHZDVFRQGXFWHGWRHQDEOHWKHGHSDUWPHQWWRXQGHUVWDQG LWV PDFUR DQG PLFURHQYLURQPHQW VR WKDW HYLGHQFHEDVHG SULRULWLHV FRXOG EH GHWHUPLQHG %URDGO\ WKH VFDQ UHYHDOHGWKHIROORZLQJNH\REVHUYDWLRQVZKLFKZHUHWKHQWKHEDVLVRIGHWHUPLQLQJWKHGHSDUWPHQW¶VVWUDWHJLF direction: The rural development and agrarian transformation space is complex, characterized by multiple causation and IHHGEDFNORRSVZLWKWLPHGHOD\V The department is the de factoQDWLRQDOODQGDGPLQLVWUDWRUDQGVSDWLDOSODQQHU,WFRXOGXVHODQGDQGVSDWLDO SODQQLQJDVOHYHUVWRLQÀXHQFHWKHWDUJHWLQJRISULRULW\UXUDODUHDVIRUGHYHORSPHQWE\XVLQJLWVODQGUHIRUPDQG VSDWLDOSODQQLQJSURJUDPPHV )XUWKHUWKHGHSDUWPHQWFRXOGVWUDWHJLFDOO\ORFDWHQHZEODFNSOD\HUVWREHQH¿WIURPSODQQHGPLQLQJYHQWXUHV (such as gas in the Northern Cape, platinum in Limpopo) through the land reform and Rural Enterprises and ,QGXVWULDO'HYHORSPHQW5(,'SURJUDPPHV Infrastructure development projects, such as SIP II, are laying the foundations to bring isolated rural areas into WKHPDLQVWUHDPHFRQRP\ The CRDP evaluation study conducted by the department and the Department of Performance Monitoring and Evalu- ation (DPME) suggests that although the programme is a good one to address the plight of rural communities, it is not GRLQJZHOOLQMREFUHDWLRQDQGFRPPXQLW\HPSRZHUPHQW0RVWRIWKHMREVFUHDWHGDUHLQIUDVWUXFWXUHUHODWHGVKRUWWHUP MREVZLWKUHODWLYHO\ORZZDJHVZKLFKKDYHQRWUHVXOWHGLQVXEVHTXHQWORQJWHUPMREVRUSHUPDQHQWHQWU\LQWRWKHODERXU PDUNHW7KHVHREVHUYDWLRQVZLOOEHFRQVLGHUHGRYHUWKHQH[W¿YH\HDUVDVWKHGHSDUWPHQWUH¿QHVWKH&5'3:HDN- nesses in coordinating planning and implementation of rural development across the spheres and within the various VHFWRUVRIJRYHUQPHQWKDYHDOVREHHQLGHQWL¿HGDVLPSHGLPHQWVWRVXFFHVVIXOO\LPSOHPHQWLQJUXUDOGHYHORSPHQW 3HUIRUPDQFH(QYLURQPHQW An assessment of progress made since 2009 indicates that tremendous gains in the upliftment of rural communities and ODQGUHIRUPEHQH¿FLDULHVKDYHEHHQPDGH3URJUHVVLVGHWHUPLQHGDJDLQVWWKHVWUDWHJLFJRDOVDQGREMHFWLYHVVHWLQ DQGVXEVHTXHQWO\UHYLHZHGZKHUHQHFHVVDU\RYHUWKH\HDUV&RPPHQGDEOHSURJUHVVZDVPDGHLQWKHLPSOHPHQWDWLRQ RIODQGUHIRUPODQGDGPLQLVWUDWLRQDQGUXUDOGHYHORSPHQWSURJUDPPHVDQGLQLWLDWLYHV3HUIRUPDQFHDVVHVVPHQWLQNH\ departmental programmes is as follows: 22 3HUIRUPDQFHLQODQGUHIRUPLQGLFDWHGDVLJQL¿FDQWLPSURYHPHQWLQWKHODVW¿YH\HDUVLQERWKWKHDUHDRIODQG DFTXLVLWLRQDQGODQGUHFDSLWDOLVDWLRQGHYHORSPHQWDVFRPSDUHGWRWKH¿UVW\HDUVRIWKHGHPRFUDWLFJRYHUQ- PHQW7KLVLVGHVSLWHWKHLQYHVWPHQWFRVWVKDYLQJWREHVKDUHGEHWZHHQWKHWZRDSSURDFKHVRIDFTXLVLWLRQDQG GHYHORSPHQWDQGKDYLQJWRSXWDVLGHRIWKHSURJUDPEXGJHWVWULFWO\LQWRUHFDSLWDOLVDWLRQGHYHORSPHQW Performance trends in the recapitalisation and development of land reform farms indicate that there has been DQLPSUHVVLYHXSWDNHRIWKHSURJUDPPH7KLVLVHYLGHQFHGE\DQLQFUHDVHLQWKHQXPEHURIIDUPVUHFDSLWDOLVHG DQGGHYHORSHGVLQFHWKHLQWURGXFWLRQRIWKHSURJUDPPH7KLVGRHVQRWPHDQWKDWWKHSURJUDPPHKDVEHHQ YRLGRIFKDOOHQJHV(YDOXDWLRQVWXGLHVFRQGXFWHGE\WKHGHSDUWPHQWLQFROODERUDWLRQ ZLWKWKH'HSDUWPHQWRI Performance Monitoring and Evaluation (DPME) found that employment creation, both directly and indirectly, KDVEHHQSRVLWLYHDOWKRXJKZHDN7KHVHFKDOOHQJHVZLOOEHDGGUHVVHGWKURXJKWKHUHYLVHG5$'3SROLF\ 7UHQGVUHFRUGHGE\WKHLQGLFDWRUVPHDVXULQJWKHHI¿FLHQF\RISURFHVVLQJUHJLVWHUDEOHGLDJUDPVJHQHUDOSODQV DQGVHFWLRQDOSODQVLPSURYHGIURPDQDYHUDJHRIGD\VDWWKHHQGRIWKH¿QDQFLDO\HDUWRDQDYHUDJH RIGD\VLQWKHPLGGOHRIWKH¿QDQFLDO\HDU Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Trends recorded in indicators measuring food security interventions at household level show that although SURJUHVVKDVEHHQVORZWKHUHLVDGH¿QLWHLQFUHDVHLQWKHQXPEHURIKRXVHKROGVDVVLVWHGWRSURGXFHWKHLURZQ IRRGWKLVKDVKDGDSRVLWLYHLPSDFWRQIRRGVHFXULW\DWKRXVHKROGOHYHO -REFUHDWLRQWKURXJKWKHGHSDUWPHQW¶VSURJUDPPHVKDVEHHQTXLWHGLVDSSRLQWLQJ7KHQXPEHURIMREVFUHDWHG WKURXJKWKH5$'3DUHWRRVPDOOWRMXVWLI\WKHDPRXQWRILQYHVWPHQW The CRDP evaluation study suggests that although the programme is a good one to address the plight of rural FRPPXQLWLHVLWLVQRWGRLQJZHOOLQMREFUHDWLRQDQGFRPPXQLW\HPSRZHUPHQW0RVWRIWKHMREVFUHDWHGDUH LQIUDVWUXFWXUHUHODWHGVKRUWWHUPMREVZLWKUHODWLYHO\ORZZDJHVZKLFKKDYHQRWUHVXOWHGLQVXEVHTXHQWORQJ WHUPMREVRUSHUPDQHQWHQWU\LQWRWKHODERXUPDUNHW7KHVHREVHUYDWLRQVZLOOEHFRQVLGHUHGRYHUWKHQH[W¿YH \HDUVDVWKHGHSDUWPHQWUH¿QHVWKH&5'3 3HUIRUPDQFHWUHQGVLQWKHVHWWOHPHQWDQG¿QDOLVDWLRQRIODQGFODLPVKDYHEHHQFRQVLVWHQW+RZHYHUWKHUHR- SHQLQJRIODQGFODLPVDQGWKHH[WHQVLRQRIWKHORGJHPHQWGDWHPHDQVWKDWWKHGHSDUWPHQWQHHGVWRDO- ORFDWHPRUHUHVRXUFHV¿QDQFLDOWHFKQLFDODQGKXPDQWRWKHUHVWLWXWLRQSURJUDPPH The department has now institutionalized the new way of integrated services improvement mechanism through a 9,578286&<&/(02'(/WKDWLVPHDQWDFKLHYHKLJKOHYHOVFRRUGLQDWHGSODQQLQJDQGLPSOHPHQWDWLRQ %HORZLVWKHGLDJUDPPDWLFSUHVHQWDWLRQRIWKHYLUWXRXVF\FOH CRDP VIRTUOS CYCLE SDF (Rural Development Plan) ,GHQWL¿FDWLRQ of wards/ farms 3UR¿OLQJ Baseline report Community Based Plan Relevant sector department Municipality Social Organisation Business Plans THIS VIRTUOS CYCLE IS UNPACKED IN THE FIVE Approval DRDLR Private Sector STAGES THAT FOLLOW Implementation Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 23 PHASE 1 PHASE 2 PHASE 3 Spatial Targeting Provincial Rural Development Community Mobilisation Provincial Rural (Revised Annually) Plan (Revised bi-annually) (Ongoing) Implementation Plan Lead: SPLUM Lead: PSSC Lead: PSSC (Ongoing) Community Community Implemen- Plan Develop- 3URYLQFLDO ment Plan DFWLYLWLHV PSSC SPLUM: Mapping of Draft Rural Targeting Plan REID: Community SUR¿OLQJ Input LR properties Draft Rural Targeting Plan REID: Community SUR¿OLQJ LR properties Restitution Claims RID: Infrastructure Delivered/Planned GATE 1 Rural tation Plan Develop- Develop- Plan, /RFDO ment Plan ment Plan includes Municipali- 3URYLQFLDO Enter- ties Sector prise Plan, /RFDO Depart- Infrastruc- Communi- ments ture Plan, ties 'LVWULFWV Land /RFDO Targeting Municipali- Plan ties Branches and key Branches and key DFWLYLWLHV DFWLYLWLHV PSSC Coordination PSSC Coordination SPLUM: Status Quo REID: Community REID: Community Organisation (COS SUR¿OLQJ and Enterprises Participatory HWF'HYHORSPHQW Rural Appraisals of BusinessPlans RID: Infrastructure RID: Infrastructure Assessments Implementation Plan LR: Land Targeting GATE 2 MONITORING AND EVALUATION FEEDBACK LOOP 24 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 CRDP APPROVALS COMMITEE ments Targeting Rural Approved Provincial Rural Development Plan Rural Rural Depart- Output Draft Provincial Rural Development Plan Provincial Targeting Sector Input Output Rural Approved Provincial Rural Development Plan Approved Rural Targeting Plan 3ULRULWLVHG 3ULRULWLVHG 3URYLQFLDO Branches and key Development Restitution Claims Output $SSURYHG Input Analysis, Input 'UDIW Draft Provincial Rural Development Plan SPLUM: Mapping, Output $SSURYHG CRDP APPROVALS COMMITEE Output DFWLYLWLHV Input Input Branches and key Output Input Output 3ROLFLHV 'UDIW &DELQHW Rural decisions Targeting 6WDWVVD Plan reports 0DSV 1DWLRQDO sector 'HSDUWPHQWDO Databases &RPPXQLW\ SUR¿OLQJ /5SURSHUW\ 5HVWLWXWLRQ claims MMC AND DDG FORUM Lead: PSSC GATE 3 PHASE 4 IF LAND REQUIRED THIS PHASE IS INCLUDED 6WUDWHJLF$FTXLVLWLRQV Rural Development (Lead: LR) Project Implementation (Lead: REID/RID), supported by EPMO Input Output 1/$& $SSURYHG 1/$& Provincial Recom- Provincial Recom- Implementa- mendation Implementa- mendation tion Plan of tion Plan of 3/$& strategic 3/$& strategic 'LVWULFW DTXLVLWLRQ 'LVWULFW DTXLVLWLRQ CRDP of land CRDP of land Output Input SPLUM: Mapping GATE 4 6XSSRUWHG/DQG$FTXLVLWLRQ3ODQ Report developed &26 DFWLYLWLHV Input LR: PLAC and NLAC Structure Branches and key MMC DFWLYLWLHV NLAC Recommendation Branches and key CRDP STRATEGIC FORUM &26 Output Structure $SSURYHG/DQG$FTXLVLWLRQ3ODQ Output $SSURYHG 6XSSRUWHG/DQG$FTXLVLWLRQ3ODQ Input REID: Building Enterprises and Industries REID: Continued Community Development and Support RID: Implementation SPLUM: Status Quo updating (annually) GATE 5 MONITORING AND EVALUATION FEEDBACK LOOP Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 25 2UJDQLVDWLRQDO(QYLURQPHQW Organisational establishment 7KHGHSDUWPHQWKDGDIXQGHGHVWDEOLVKPHQWRISRVWVDQGSRVWVDUH¿OOHGLQDGGLWLRQWRWKLVHVWDEOLVKPHQW The former land reform branch was split into two branches, namely Land Tenure and Administration, and Land Redis- WULEXWLRQDQG'HYHORSPHQW7KLVKDVUHSRVLWLRQHGWKHGHSDUWPHQWWREHWWHUH[HFXWHLWVPDQGDWHDWUHJLRQDODQGGLVWULFW OHYHOV7KHVSOLWDOVRKDVDQLPSDFWRQWKHVL]HRIWKHGHSDUWPHQW¶VRUJDQLVDWLRQDOHVWDEOLVKPHQW2YHUWKHQH[W¿YH \HDUVLWLVDQWLFLSDWHGWKDWWKHUHZLOOEHDQLQFUHDVHLQWKHQXPEHURIIXQGHGSRVWV7RVWUHQJWKHQWKHLPSOHPHQWDWLRQRI &5'3WKHGHSDUWPHQWLVSODQQLQJWRGHYHORSDEXVLQHVVRSHUDWLQJPRGHOIRUWKHUXUDOGHYHORSPHQWSURJUDPPH Skills development 6NLOOVGHYHORSPHQWZLOOEHRQHRIWKHGHSDUWPHQW¶VSULRULWLHVRYHUWKHQH[W¿YH\HDUV6NLOOVGHYHORSPHQWLQWKHGHSDUW- ment is informed by the National Skills Development Strategy (NSDS) III and the Human Resource Development (HRD) 6WUDWHJ\RI6RXWK$IULFDZKLFKHQDEOHVWKHGHSDUWPHQWWRGHYHORSHGXFDWHDQGHTXLSHPSOR\HHVWREHFRPHDVNLOOHG FDSDEOHZRUNIRUFHWKDWVKDUHVDQGFRQWULEXWHVWRWKHEHQH¿WVDQGRSSRUWXQLWLHVRIHFRQRPLFH[SDQVLRQDQGDQLQFOXVLYH JURZWKSDWK7KHVHVWUDWHJLHVHQDEOHWKHGHSDUWPHQWWRSRVLWLRQLWVHOILQLGHQWLI\LQJSULRULW\VNLOOVQHHGHGIRUWKHVXFFHVV- IXOH[HFXWLRQRIFXUUHQWVWUDWHJLHV$VNLOOHGDQGFDSDEOHZRUNIRUFHZLOOHQVXUHWKDWVHUYLFHGHOLYHU\LVLPSURYHGWKXV HQDEOLQJWKHGHSDUWPHQWWRUHDOLVHLWVVWUDWHJLFJRDOVDQGREMHFWLYHV 26 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 MACRO ORGANISATIONAL STRUCTURE Mr GE Nkwinti Minister of Rural Development and Land Reform Ms P Tshwete Deputy Minister of Rural Development and Land Reform Mr PM Shabane Director General Ms N Gobodo Mr V Mahlangu Dr N Makgalemele Dr M Swartz Ms L Archary Mr B Mbatha Mr M Riba Mr P Sekawana Mr T Motsoeneng Chief Land Claims Commissioner Deputy Director General Deputy Director General Deputy Director General Deputy Director General Chief Surveyor General Acting Deputy Director General Acting Chief )LQDQFLDO2I¿FHU Land Reform & Administration Spatial Planning and Land Use Management Acting Chief Registrar of Deeds Social, Technical Rural Livelihood & Institutional Facilitation * Rural Infrastructure Development Deeds Registration National Geomatics Management Service Corporate Support Services Financial Services Commission on Restitution of Land Rights *The name of this branch has since been changed to Rural Enterprise and Industrial Development (REID) Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 27 Description Of The Strategic Planning Process 7KHVWUDWHJLFSODQQLQJSURFHVVRIWKHGHSDUWPHQWFRPPHQFHGLQ$SULODQGZDV¿QDOL]HGLQ-DQXDU\7KHVWUD- tegic plan was developed by the department’s senior management through a series of strategic thinking and planning ZRUNVKRSVIDFLOLWDWHGE\WKH&KLHI'LUHFWRUDWH3ODQQLQJ0RQLWRULQJDQG(YDOXDWLRQ7KHZRUNVKRSVHQWDLOHGVWUDWHJLF discussions about the direction that rural development and land reform as priorities of government should take in order WRHQVXUHHTXLW\SRYHUW\DOOHYLDWLRQDQGHPSOR\PHQWFUHDWLRQ6WDNHKROGHUVFRQVXOWHGGXULQJWKHGHYHORSPHQWRIWKH 076)LQFOXGHGDOOWKHUROHSOD\HUVRI2XWFRPH9LEUDQWHTXLWDEOHDQGVXVWDLQDEOHUXUDOFRPPXQLWLHVDQGIRRGVHFXULW\ IRUDOO$OOWKUHHVSKHUHVRIJRYHUQPHQWZHUHFRQVXOWHGLQWKLVSURFHVV7KHUHVXOWLVDVWUDWHJLFSODQWKDWFRQVLGHUVDOO LQSXWVPDGHWKURXJKWKHVHVWDNHKROGHUHQJDJHPHQWZRUNVKRSV The following stakeholders were consulted: 'HSDUWPHQWRI$JULFXOWXUH)RUHVWU\DQG)LVKHULHV'$)) 1DWLRQDO7UHDVXU\17 'HSDUWPHQWRI7UDGHDQG,QGXVWU\GWL 'HSDUWPHQWRI&RRSHUDWLYH*RYHUQDQFH'&R* 'HSDUWPHQWRI:DWHU$IIDLUV':$ 'HSDUWPHQWRI(QYLURQPHQWDO$IIDLUV'($ 'HSDUWPHQWRI+XPDQ6HWWOHPHQWV'+6 'HSDUWPHQWRI%DVLF(GXFDWLRQ'%( 'HSDUWPHQWRI+HDOWK'R+ 'HSDUWPHQWRI+LJKHU(GXFDWLRQDQG7UDLQLQJ'+(7 'HSDUWPHQWRI7RXULVP'R7 'HSDUWPHQWRI6FLHQFHDQG7HFKQRORJ\'67 'HSDUWPHQWRI$UWVDQG&XOWXUH'$& 3URYLQFLDOGHSDUWPHQWVRIORFDOJRYHUQPHQWDQG6$/*$ The plan is aligned to the National development plan 2030 vision and trajectory and the Medium Term Strategic Frame- ZRUNGHULYHGIURPLW7KH1'3YLVLRQLVUXUDODUHDVZKLFKDUHVSDWLDOO\VRFLDOO\DQGHFRQRPLFDOO\ZHOOLQWHJUDWHG across municipal, district and provincial and regional boundaries—where residents have economic growth, food security and jobs as a result of agrarian transformation and infrastructure development programmes, and have improved access WREDVLFVHUYLFHVKHDOWKFDUHDQGTXDOLW\HGXFDWLRQ $FKLHYLQJWKLVYLVLRQZLOOUHTXLUHOHDGHUVKLSRQODQGUHIRUPFRPPXQDOWHQXUHVHFXULW\¿QDQFLDODQGWHFKQLFDOVXSSRUWWR IDUPHUVDQGWKHSURYLVLRQRIVRFLDODQGSK\VLFDOLQIUDVWUXFWXUHIRUVXFFHVVIXOLPSOHPHQWDWLRQ,WZLOODOVRUHTXLUHFDSDFLW\ EXLOGLQJWRHQDEOHVWDWHLQVWLWXWLRQVDQGSULYDWHLQGXVWULHVWRLPSOHPHQWWKHVHLQWHUYHQWLRQV,PSURYHGFRRUGLQDWLRQDQG integration in the planning and implementation of area-based and differentiated rural development plans will be needed RYHUWKHPHGLXPWHUPWRDFKLHYHWKHYLVLRQRIDQLQFOXVLYHUXUDOHFRQRP\7KH1'3VWDWHVWKDWVLQFHWKHPDLQ challenge for rural development has been marginalisation of the poor, with many rural areas and households trapped LQDYLFLRXVF\FOHRISRYHUW\5XUDODUHDVDQGFRPPXQLWLHVUHTXLUHJUHDWHUVRFLDOHFRQRPLFDQGSROLWLFDORSSRUWXQLWLHV WRRYHUFRPHWKHOHJDF\RIPDUJLQDOL]DWLRQDQGSRYHUW\*RYHUQPHQWVWDNHKROGHUVLPSDFWLQJRQUXUDOGHYHORSPHQWZLOO have to work in tandem to create an integrated and inclusive rural economy, starting with mutual acknowledgement of the following problems: 7KDWDSDUWKHLG¶VVSDWLDOGHVLJQSDWWHUQVLQHYLWDEO\UHVXOWHGLQIUDJPHQWHGDQGVHJUHJDWHGGHYHORSPHQW planning, without viable economic, social and cultural linkages between the economically active and UHODWLYHO\SURVSHURXVFRPPHUFLDOXUEDQDUHDVRIWKHFRXQWU\DQGWKHUXUDOKLQWHUODQG&KURQLFXQGHUGHYHOR pment with its social, economic and cultural manifestations through poverty, unemployment, rural-urban LQFRPHLQHTXDOLW\VWLOOFRQWLQXHV/DQGRZQHUVKLSSDWWHUQVDUHVXFKWKDWODQGLVLQWKHKDQGVRIDIHZWKXV H[DFHUEDWLQJLQHTXDOLWLHVJLYHQWKDWWKHPDMRULW\GRQRWKDYHPHDQVRISURGXFWLRQ 7KDWODQGUHIRUPKDVQRW\HWWUDQVODWHGLQWRWKHHVWDEOLVKPHQWRIVXI¿FLHQWQXPEHUVRIVXVWDLQDEOHQHZ EODFNIDUPHUVDQGUHVWLWXWLRQLQSDUWLFXODUKDVEHHQTXLWHVORZ*HQHUDOO\WKHUHLVXQGHUXWLOLVDWLRQRISUR GXFWLYHDQGFRPPXQDOODQGDQGWKLVPLJKWWKUHDWHQIRRGVHFXULW\HVSHFLDOO\DWKRXVHKROGOHYHO 28 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 7KDWWKHHFRQRPLFJURZWKRIWKHDJULFXOWXUDOVHFWRUKDVEHHQFRQVWUDLQHGE\LQVXI¿FLHQWSURJUHVVLQ LQFUHDVLQJSURGXFWLRQHI¿FLHQF\DQGDFFHVVLQJQHZPDUNHWVDQGRSSRUWXQLWLHVWKHHIIHFWRIJOREDOLVDWLRQ RQ6RXWK$IULFD¶VFRPSHWLWLYHQHVVDQGSROLF\XQFHUWDLQW\UHVXOWLQJLQMREORVVHV/DERXUSUDFWLFHVLQ WKHVHFWRUUHPDLQDFRQFHUQZLWKWKHFRQGLWLRQVRIIDUPZRUNHUVQRWLPSURYLQJDVLQWHQGHG7UDQVIRUPDWLRQ in terms of broad-based black economic empowerment is pro-urban and not happening at the desired SDFHDQGVFDOH7KHFRQWLQXHGSUHVVXUHRQDJULFXOWXUHWRLQFUHDVHRXWSXWSHUXQLWRIODQGSRVHVDGLIIHUHQW FKDOOHQJHRIHQVXULQJWKDWWKHQDWXUDOUHVRXUFHEDVHLVSURWHFWHG,QDGGLWLRQFOLPDWHFKDQJHKDVPDVVLYH LPSDFWDFURVVWKHVHFWRU Other challenges facing rural areas include: 8QGHUXWLOL]DWLRQDQGXQVXVWDLQDEOHXVHRIQDWXUDOUHVRXUFHVLQDGHTXDWHRUODFNRIDFFHVVWRVRFLR economic infrastructure and services, public amenities and government services, as well as low literacy DQGVNLOOVOHYHOV5XUDODUHDVDOVRVWUXJJOHWRDWWUDFWVXVWDLQDEOHHQWHUSULVHVDQGLQGXVWULHVDQGDUHIXUWKHU FKDUDFWHUL]HGE\ZHDNUXUDOXUEDQOLQNDJHVSRRUDFFHVVWRORFDOPDUNHWVDQG¿QDQFLDOVHUYLFHV :HDNFRRUGLQDWLRQRISODQQLQJDQGLPSOHPHQWDWLRQRIUXUDOGHYHORSPHQWDFURVVWKHVSKHUHVDQGZLWKLQ the various sectors of government To address these challenges, a number of sectoral strategies have been developed;; however, their impact has not yet DFFUXHGWKHLQWHQGHGEHQH¿WV 3ULRULWLHVWRDFKLHYHWKLVYLVLRQRIWKH1'3LGHQWL¿HVWKHIROORZLQJSROLF\LPSHUDWLYHVZKLFKZLOOEHWKHIRFXV of the coming MTSF period: ,PSURYHGODQGDGPLQLVWUDWLRQDQGVSDWLDOSODQQLQJIRULQWHJUDWHGGHYHORSPHQWZLWKDELDVWRZDUGVUXUDODUHDV 8SVFDOHGUXUDOGHYHORSPHQWDVDUHVXOWRIFRRUGLQDWHGDQGLQWHJUDWHGSODQQLQJUHVRXUFHDOORFDWLRQ and implementation by all stakeholders 6XVWDLQDEOHODQGUHIRUPDJUDULDQWUDQVIRUPDWLRQ ,PSURYHGIRRGVHFXULW\ 6PDOOKROGHUIDUPHUGHYHORSPHQWDQGVXSSRUWWHFKQLFDO¿QDQFLDOLQIUDVWUXFWXUHIRUDJUDULDQWUDQVIRUPDWLRQ ,QFUHDVHGDFFHVVWRTXDOLW\EDVLFLQIUDVWUXFWXUHDQGVHUYLFHVSDUWLFXODUO\LQHGXFDWLRQKHDOWKFDUHDQG public transport in rural areas *URZWKRIVXVWDLQDEOHUXUDOHQWHUSULVHVDQGLQGXVWULHVFKDUDFWHULVHGE\VWURQJUXUDOXUEDQOLQNDJHV LQFUHDVHGLQYHVWPHQWLQDJURSURFHVVLQJWUDGHGHYHORSPHQWDQGDFFHVVWRPDUNHWVDQG¿QDQFLDO VHUYLFHV±UHVXOWLQJLQUXUDOMREFUHDWLRQ For subsequent MTSF cycles, the rural sector will focus on the following: /HYHUDJLQJRQHVWDEOLVKHGLQVWLWXWLRQDODUUDQJHPHQWVDQGVSDWLDOSODQQLQJWRROVDQGLQVWUXPHQWVWR further advance effective urban-rural integration, 6WUHQJWKHQLQJGHYHORSPHQWSODQQLQJEDVHGRQHIIHFWLYHVSDWLDOGHYHORSPHQWIUDPHZRUNVDWDOOWKUHH VSKHUHVWRIXUWKHUXQORFNEHQH¿WVLQWKHDJULFXOWXUDODQGQRQDJULFXOWXUDOYDOXHFKDLQ 6XVWDLQDEOHPDQDJHPHQWRIQDWXUDOUHVRXUFHV 8SVFDOLQJLPSOHPHQWDWLRQWRZDUGVDFKLHYLQJFRQFUHWHWDUJHWV Management of implementation led by the Department of Rural Development and Land Reform (DRDLR), the imple- PHQWDWLRQRIWKHDFWLRQVLQWKHWDEOHVEHORZZLOOUHTXLUHGHGLFDWHGLQYROYHPHQWDQGFROODERUDWLRQE\WKH'HSDUWPHQWRI Agriculture, Forestry and Fisheries (DAFF), National Treasury (NT), Department of Trade and Industry (DTI), Depart- ment of Cooperative Governance (DCoG), Department of Water Affairs (DWA), Department of Environmental Affairs (DEA), Department of Human Settlements (DHS), Department of Basic Education (DBE), Department of Health (DHE), Department of Higher Education and Training (DHEAT), Department of Tourism (DoT), Department of Science and 7HFKQRORJ\'67'HSDUWPHQWRI$UWVDQG&XOWXUH'$&3URYLQFLDO'HSDUWPHQWVRI/RFDO*RYHUQPHQWDQG6$/*$ 7KHPDLQFRRUGLQDWLRQPHFKDQLVPIRUUXUDOGHYHORSPHQWZLOOFRQWLQXHWRWKH5XUDO'HYHORSPHQW0LQ0HFV6XSSRUWE\ RUJDQLVHGIRUPDWLRQVLQWKHUXUDODQGDJULFXOWXUDOVHFWRUZLOODGGYDOXHWRWKHVXFFHVVIXOLPSOHPHQWDWLRQRIWKHDFWLRQV Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 29 'HSDUWPHQWDO6WUDWHJLF2XWFRPH2ULHQWHG*RDOV In line with the new developments in government and within the department, the Department of Rural Development and /DQG5HIRUPKDVLGHQWL¿HGVL[VWUDWHJLFJRDOVLWVHHNVWRDFKLHYHLQWKH¿YH\HDUSHULRGRIWKLVSODQDQGEH\RQG Strategic Goal 1 Corporate governance and service excellence Goal statement Foster corporate governance and service excellence through compliance with the legal framework Strategic Goal 2 Improve land administration for integrated and sustainable growth and development Goal statement Improve land administration and spatial planning for integrated sustainable growth and development with a bias towards rural areas Strategic Goal 3 3URPRWHHTXLWDEOHDFFHVVWRDQGVXVWDLQDEOHXVHRIODQGIRUGHYHORSPHQW Goal statement $QLQFOXVLYHDQGHTXLWDEOHODQGGLVSHQVDWLRQZLWKWUDQVIRUPHGSDWWHUQVRI land tenure and use Strategic Goal 4 Promote sustainable rural livelihoods Goal statement Improve rural livelihoods as a result of capabilities, income and job opportunities provided Strategic Goal 5 Improved access to services Goal statement Improve access to services in rural areas through the coordination of TXDOLW\LQIUDVWUXFWXUH Strategic Goal 6 Sustainable rural enterprises and industries Goal statement Promote economically, socially and environmentally viable rural enterprises and industries Strategic Goal 7 Restoration of Land Rights Goal statement Restoration of land rights in terms of three Restitution of Land Rights Act, DVDPHQGHG 30 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 3$57%6WUDWHJLF2EMHFWLYHV Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 19 31 Programme 1: Administration Purpose 3URYLGHVWUDWHJLFDQGORJLVWLFDOVXSSRUWLQWKHIRUPRIH[HFXWLYHVHUYLFHVFRUSRUDWHVHUYLFHVDQGWKHDFTXLVLWLRQRI YHKLFOHVIRUGHSDUWPHQWDOXVH2YHUVHHGHSDUWPHQWDOFDSLWDOZRUNV3URYLGHEXUVDULHVWRQRQHPSOR\HHV Programme structure 7KH$GPLQLVWUDWLRQSURJUDPPHFRPSULVHRIWKHIROORZLQJVXESURJUDPPHV Ministry Management Internal Audit Corporate Services Financial Services Provincial Coordination 2I¿FH$FFRPPRGDWLRQ Strategic objectives 7KHWDEOHVEHORZSURYLGHWKHSURJUDPPH¶VVWUDWHJLFREMHFWLYHV 6WUDWHJLF2EMHFWLYH Compliance with all public sector legal prescripts 2EMHFWLYHVWDWHPHQW Ensure 100% compliance with government regulations and legal prescripts by 2019 Baseline New indicator -XVWL¿FDWLRQ 7KLVREMHFWLYHZLOOSURPRWHJRRGJRYHUQDQFHDQGPHDVXUHFRPSOLDQFH Links Linked to Public Service Regulations and policies 6WUDWHJLF2EMHFWLYH 8QTXDOL¿HGUHJXODULW\DXGLWRSLQLRQ 2EMHFWLYHVWDWHPHQW 2EWDLQDQXQTXDOL¿HGUHJXODULW\DXGLWRSLQLRQRQ¿QDQFLDODQGQRQ¿QDQFLDO performance by 2019 Baseline 8QTXDOL¿HGDXGLWUHSRUW -XVWL¿FDWLRQ This strategic objective will ensure that there is improved accountability on public resources, service delivery and that the department complies with SUHVFULSWVJRYHUQLQJWKHSXEOLFVHFWRU Links /LQNHGWR6WUDWHJLF*RDO 32 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 6WUDWHJLF2EMHFWLYH Skills development for improved service delivery 2EMHFWLYHVWDWHPHQW Improve employees’ and prospective employees skills to enhance service delivery by 2019 Baseline SURVSHFWLYHHPSOR\HHVWUDLQHG -XVWL¿FDWLRQ This objective aims to promote a capable and professional workforce to DFKLHYHVHUYLFHH[FHOOHQFH Links /LQNHGWR6WUDWHJLF*RDO Resource Considerations 7KHVSHQGLQJIRFXVRYHUWKHPHGLXPWHUPZLOOEHRQSURYLGLQJFRUSRUDWHVHUYLFHV¿QDQFLDOVHUYLFHVDQGSURYLQFLDOFR- RUGLQDWLRQZLWKLQWKHGHSDUWPHQWWRDFKLHYHJRRGFRUSRUDWHJRYHUQDQFHDQGVHUYLFHH[FHOOHQFH2YHUWKHPHGLXPWHUP period, expenditure on the compensation of employees is expected to increase as a result of a change on Standard &KDUWVRI$FFRXQWV6&2$FODVVL¿FDWLRQLWHPVZKHUHOHDUQHUVKLSDQGLQWHUQVKLSDUHQRZSDLGXQGHUFRPSHQVDWLRQRI HPSOR\HHV7KHSURJUDPPHKDVDIXQGHGHVWDEOLVKPHQWRISRVWVRIZKLFKZHUH¿OOHGE\1RYHPEHU DQGSRVWVZHUH¿OOHGLQDGGLWLRQWRWKLVHVWDEOLVKPHQW Expenditure on the compensation of employees is expected to increase over the medium term as a result of an increase in the number of posts to develop internal capacity towards IT governance and the enterprise programme management RI¿FHWRVXSSRUWOLQHIXQFWLRQVHUYLFHVLQSURYLGLQJHIIHFWLYHHI¿FLHQWDQGHFRQRPLFVHUYLFHGHOLYHU\ Risk Management Risk Risk response/mitigation plan Weak and fragmented ICT environment and infrastructure IT platform upgrades in progress Systems integration and interconnectivity are being explored co-sourcing options to be explored Misalignment between business operating model, organisational structure and strategic objectives Finalisation and approval of the business operating model and macro-structure Failure to maintain vacancy rate at 10% Vacancy management plan developed fast- WUDFNLQJRITXDOL¿FDWLRQYHUL¿FDWLRQZLWK6$4$ fast-tracking pre-employment screening )UDXGDQGFRUUXSWLRQLQWKHDFTXLVLWLRQ of goods and services Implementation of the fraud prevention strategy Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 33 Risk Risk response/mitigation plan Inability to achieve a clean audit report by 2014 8SGDWHH[LVWLQJ¿QDQFLDOSROLFLHVWRDFNQRZOHGJH lack of legislation and to document compensating FRQWUROVHJWUDQVIHUSD\PHQWV Monitoring the implementation of the external and internal audit action plans 34 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 3URJUDPPH*HRVSDWLDODQG&DGDVWUDO6HUYLFHV Purpose Provide geospatial information, cadastral surveys, deeds registration and spatial planning, as well as technical services LQVXSSRUWRIVXVWDLQDEOHODQGGHYHORSPHQW Programme structure The programme consists of the following subprogrammes: National Geomatics Management Services Spatial Planning and Land Use Management Registration of Deeds Trading Account South African Council for Planners Strategic objectives 7KHWDEOHVEHORZSURYLGHWKHSURJUDPPH¶VVWUDWHJLFREMHFWLYHV 6WUDWHJLF2EMHFWLYH Improved spatial planning 2EMHFWLYHVWDWHPHQW Facilitate integrated spatial planning and land use management in all provinces through the application of relevant legislation by 2019 Baseline Fragmented spatial planning and land use management -XVWL¿FDWLRQ &RQWULEXWHVWRZDUGVVSDWLDOHTXLW\ Links NDP, Outcome 7 and Strategic Goal 2, 3 and 5 6WUDWHJLF2EMHFWLYH An integrated and comprehensive land administration system 2EMHFWLYHVWDWHPHQW Ensure an integrated and comprehensive land administration system Baseline Incomplete and non-reformed land administration systems -XVWL¿FDWLRQ This objective will ensure the promotion of sustainable growth and GHYHORSPHQW Links Outcome 7, Strategic Goal 2 and 3 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 35 Resource Considerations Spending over the medium term will focus on the implementation of the Spatial Planning and Land Use Management, DQG1DWLRQDO*HRPDWLFV0DQDJHPHQW6HUYLFHVVXESURJUDPPHVDVZHOODVRQ¿QDOLVLQJWKHODQGUHJLVWHUWRHQKDQFH HIIHFWLYHODQGSODQQLQJDQGDGPLQLVWUDWLRQ 2YHUWKHVDPHSHULRGH[SHQGLWXUHRQJRRGVDQGVHUYLFHVLVH[SHFWHGWRVOLJKWO\LQFUHDVHIURP5PLOOLRQWR5 million due to the implementation of SPLUMA, state domestic surveys, and the development of guidelines, tools and V\VWHPVWRIDFLOLWDWHDQGFRRUGLQDWHWKHLPSOHPHQWDWLRQRIWKHDFWE\WKHPXQLFLSDOLWLHV 7KHSURJUDPPHKDVDIXQGHGHVWDEOLVKPHQWRISRVWV([SHQGLWXUHRQWKHFRPSHQVDWLRQRIHPSOR\HHVLVH[SHFWHG WRLQFUHDVHRYHUWKHPHGLXPWHUPIURP5PLOOLRQWRPLOOLRQPDLQO\EHFDXVHRIWKHQHHGWRLQFUHDVHWKHQXPEHU RISRVWVLQRUGHUWRLPSOHPHQWWKH63/80$ Risk Management Risk Risk response/mitigation plan ,QDGHTXDWH*HRPDWLFVVNLOOVEDVHLQWKH country and ageing staff Continue with the bursary scheme and aware- ness programmes in order to attract young SHRSOHWRWKHSURIHVVLRQ Title deeds not registered in accordance with prevailing laws and regulations Implement compliance monitoring in all Deeds Registries In accordance with Deeds Registries $FWRIDQG6HFWLRQDO7LWOHV$FWRI ,QDELOLW\WRLPSURYHHI¿FLHQF\DQG accuracy of South Africa’s land information management due to delay in the implementation of the e-Cadastre project Project governance framework has been done for H&DGDVWUHDQGOHDGHUVKLSHOHYDWHGWRWKH'* The Chief Surveyor General has been seconded WREHWKH3URJUDPPHGLUHFWRU An industry expert in IT project management to assist with the re-scoping and re-strategizing of WKHSURMHFWDQGVXEVHTXHQWWRWKDWSURYLGH SURMHFWTXDOLW\DVVXUDQFH 36 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Risk Risk response/mitigation plan The Dutch cadastre team was engaged to assist in providing advice as input to the re-scoping of the project and may be called upon for further assis- tance where necessary during the project imple- mentation will contribute in business and technical expertise on all products as an initial activity for all products submitted as well as on a continuous basis during the life cycle of the project Lack of capacity at provincial and local sphere to monitor and implement SPLUMA Training and Capacity Development Programme implemented nationally Municipal Readiness Assessment exercise conducted to determine municipal capacity UHTXLUHPHQWVWRLPSOHPHQW63/80$ Develop Technical Tools and Systems for effective Spatial Planning and Land Use Management throughout the country Poor inter-governmental co-ordination of activities on the implementation of SPLUMA Provide intergovernmental support in terms of chapter 3 of SPLUMA through facilitation of SPLUMA Implementation National Coordinating Forum Municipal Readiness Assessment exercise conducted to determine municipal capacity UHTXLUHPHQWVWRLPSOHPHQW63/80$ Risk Risk response/mitigation plan ,QDGHTXDWH*HRPDWLFVVNLOOVEDVHLQWKH country and ageing staff Continue with the bursary scheme and awareness programmes in order to attract young people to the profession Potential lack of buy-in by tribal authorities in acknowledging surveyed boundaries Enable negotiations and provide clarity to facilitate the signing of beacon agreements ,QDELOLW\WRLPSURYHHI¿FLHQF\DQG accuracy of South Africa’s land information management due to delay in the implementation of the e-Cadastre project Project governance framework has been done for e-Cadastre and leadership elevated to the DG Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 37 Risk Risk response/mitigation plan An industry expert in IT project management to assist with the re-scoping and UHVWUDWHJLVLQJRIWKHSURMHFWDQGVXEVHTXHQW WRWKDWSURYLGHSURMHFWTXDOLW\DVVXUDQFH A foreign government entity will contribute in business and technical expertise on all products as an initial activity for all products submitted as well as on a continuous basis during the life cycle of the project The capacity and/or readiness of SPLUMA branch to assist the department to carry out its coordination role in rural development Implementation of the change management strategy to ensure implementation of SPLUMA Possible litigation in implementation of SPLUMA (especially as it relates to scope of municipal planning powers) Provincial law reform being supported by the department, and intensive training and communication on SPLUMA 38 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 3URJUDPPH5XUDO'HYHORSPHQW Purpose Initiate, facilitate, coordinate, and act as a catalyst for the implementation of a comprehensive rural development pro- JUDPPHOHDGLQJWRVXVWDLQDEOHDQGYLEUDQWUXUDOFRPPXQLWLHV Programme structure The programme consists of the following subprogrammes: The programme consists of the following subprogrammes: Rural Infrastructure Development (RID) Rural Enterprise and Industry Development (REID) National Rural Youth Service Corps (Narysec) Strategic objectives 7KHWDEOHVEHORZSURYLGHWKHSURJUDPPH¶VVWUDWHJLFREMHFWLYHV 6WUDWHJLF2EMHFWLYH Support to rural communities to produce their own food in all rural districts 2EMHFWLYHVWDWHPHQW Provide support to rural communities in all rural districts to enable them to improve their livelihoods by 2019 Baseline KRXVHKROGVSURYLGHGZLWKVXSSRUW -XVWL¿FDWLRQ 7KHVWUDWHJLFREMHFWLYHZLOOFRQWULEXWHWRZDUGVIRRGVHFXULW\LQUXUDODUHDV Links /LQNHGWR6WUDWHJLF*RDODQG2XWFRPH 6WUDWHJLF2EMHFWLYH Quality infrastructure provided 2EMHFWLYHVWDWHPHQW Improve access to services in rural areas by coordinating and providing integrated infrastructure by 2019 Baseline -XVWL¿FDWLRQ The strategic objective will contribute towards improved rural livelihoods by IDFLOLWDWLQJWKHSURYLVLRQRITXDOLW\LQIUDVWUXFWXUH Links /LQNHGWR&5'32XWFRPH6WUDWHJLF*RDODQG %XONLQIUDVWUXFWXUH 3XEOLFDPHQLWLHVFRPSOHWHG ,&7SURMHFWVFRPSOHWHG (FRQRPLFLQIUDVWUXFWXUHFRPSOHWHG Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 39 6WUDWHJLF2EMHFWLYH 2EMHFWLYHVWDWHPHQW Facilitate the establishment of rural enterprises and industries Facilitate the development of 235 rural enterprises and industries in areas with economic development potential and opportunities by 2019 Baseline 1HZLQGLFDWRU -XVWL¿FDWLRQ 7KHVWUDWHJLFREMHFWLYHZLOOFRQWULEXWHWRZDUGV&5'3LQLWLDWLYHV Links /LQNHGWR&5'32XWFRPHDQG6WUDWHJLF*RDO 6WUDWHJLF2EMHFWLYH Job creation and skills development in rural areas 2EMHFWLYHVWDWHPHQW Increase job opportunities and ensure skills development through CRDP and land reform initiatives by 2019 Baseline 1XPEHURIMREVFUHDWHGLQUXUDODUHDV 1XPEHURISHRSOHWUDLQHGLQUXUDODUHDV -XVWL¿FDWLRQ The strategic objective will contribute towards the reduction of XQHPSOR\PHQWLQUXUDODUHDV Links 2XWFRPH&5'3DQG6WUDWHJLF*RDODQG Resource Considerations Spending over the medium term will focus on implementing rural livelihood strategy, providing technical support to municipalities, coordinating and facilitating infrastructure projects, supporting irrigation schemes, developing and imple- PHQWLQJDUXUDOHQWHUSULVHVDQGLQGXVWULDOGHYHORSPHQWVWUDWHJ\VNLOOVDQG\RXWKGHYHORSPHQWDQGMREFUHDWLRQ ([SHQGLWXUHRQJRRGVDQGVHUYLFHVLQFUHDVHGVLJQL¿FDQWO\EHWZHHQDQGGXHWRWKHHPSOR\PHQWRI additional participants in the NARYSEC, and as well as due to the training of recruits in ensuring that new and existing UHFUXLWVDWWDLQWKHUHTXLVLWHOHYHORIVNLOOV7KHFRVWVRIJRRGVDQGVHUYLFHVLQFUHDVHGIURP5PLOOLRQWR5PLOOLRQ 7KHSURJUDPPHKDVDIXQGHGHVWDEOLVKPHQWRISRVWVRIZKLFKZHUH¿OOHGE\1RYHPEHUDQGWZRSRVWV ZHUH¿OOHGLQDGGLWLRQWRWKLVHVWDEOLVKPHQW([SHQGLWXUHRQWKHFRPSHQVDWLRQRIHPSOR\HHVLVH[SHFWHGWRLQFUHDVHRYHU the medium term as a result of an increase in the number of posts as internal capacity is developed to implement the FRPSUHKHQVLYHUXUDOGHYHORSPHQWSURJUDPPH Risk Management 40 Risk Risk response/mitigation plan ,QDGHTXDWHVWUDWHJLFIRFXVRQUXUDO development niche or gap The branch is in the process of further developing YDULRXVSROLFLHVIRUUXUDOGHYHORSPHQW,WZLOOZRUN WRJHWKHUZLWKWKH3ROLF\8QLWLQIXUWKHUGH¿QLQJWKH YDULRXVUROHVDVVXPHGE\WKHGHSDUWPHQW Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Risk Risk response/mitigation plan Inter-branch planning to guide implementation for 5,'SURMHFWV Lack of integrated planning and coordination between the Rural Infrastructure Development (RID), REID, SPLUMA, Land Reform and other stakeholders Finalisation and implementation of the Intergovernmental Relations (IGR) Framework Implementation of the virtuous CRDP cycle Poor social mobilisation and organisation Finalisation of the rural development policy and legislation Development of a policy for community engagement mobilisation and organisation Sustainability of cooperatives Collaborations with other government departments such as the dti to improve support cooperatives Developing and improving on governance framework Rural infrastructure and enterprise LQLWLDWLYHVPD\QRWVXI¿FLHQWO\FRQWULEXWH to creation of decent jobs Engaging with strategic partnerships in the private sector to invest in rural enterprises and infrastructure development Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 41 Programme 4: Restitution Purpose Settle land restitution claims under the Restitution of Land Rights Act (1994) and provide settlement support to EHQH¿FLDULHV Programme structure The programme consists of the following subprogrammes: The programme consists of the following sub-programmes: 5HVWLWXWLRQ1DWLRQDO2I¿FH 5HVWLWXWLRQ3URYLQFLDO2I¿FHV Restitution Grants Strategic objectives 7KHWDEOHVEHORZSURYLGHWKHSURJUDPPH¶VVWUDWHJLFREMHFWLYHV 6WUDWHJLF2EMHFWLYH Land rights restored 2EMHFWLYHVWDWHPHQW )DFLOLWDWHWKHUHVWRUDWLRQRIODQGULJKWVDQGDOWHUQDWLYHIRUPVRIHTXLWDEOH redress by 2019 Baseline 1XPEHURIODQGULJKWVUHVWRUHGRUDZDUGVRIDOWHUQDWLYHHTXLWDEOHUHGUHVVLQ 0DUFK -XVWL¿FDWLRQ (TXLWDEOHODQGGLVSHQVDWLRQDQGDJUDULDQUHIRUP Links /LQNHGWR6WUDWHJLF*RDO 6WUDWHJLF2EMHFWLYH Redress land rights lost after 1913 2EMHFWLYHVWDWHPHQW )DFLOLWDWHWKHUHRSHQLQJDQG¿QDOLVDWLRQRIWKHORGJHPHQWRIUHVWLWXWLRQODQG FODLPVSHRSOHZKRGLGQRWPHHWWKHGHDGOLQH Baseline ODQGFODLPVZHUHORGJHGE\WKHFXWRIIGDWHRI'HFHPEHU -XVWL¿FDWLRQ (TXLWDEOHODQGGLVSHQVDWLRQDQGDJUDULDQUHIRUP Links /LQNHGWR6WUDWHJLF*RDO 42 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Resource Considerations 6SHQGLQJRYHUWKHPHGLXPWHUPZLOOIRFXVRQVHWWOLQJDQG¿QDOLVLQJUHVWLWXWLRQFODLPVWRLQFUHDVHDFFHVVWRODQGDQG LPSURYHWKHSURGXFWLYHXVHRIODQG%HWZHHQDQGH[SHQGLWXUHLQWKH5HVWLWXWLRQ1DWLRQDO2I¿FHDQG 5HVWLWXWLRQ5HJLRQDO2I¿FHVVXESURJUDPPHVLQFUHDVHGLQVXSSRUWRIVSHHGLQJXSWKHUHVWLWXWLRQSURFHVVLQOLJKWRIWKH UHRSHQLQJRIWKHORGJPHQWVRIUHVWLWXWLRQFODLPV,QWKHVDPHSHULRGH[SHQGLWXUHRQFRQVXOWDQWVGHFUHDVHGGXHWRWKH XVHRILQWHUQDOUHVRXUFHV 7KHSURJUDPPHKDVDIXQGHGHVWDEOLVKPHQWRISRVWVRIZKLFKZHUH¿OOHGE\1RYHPEHUDQGSRVWV ZHUH¿OOHGLQDGGLWLRQWRWKLVHVWDEOLVKPHQW6SHQGLQJRQWKHFRPSHQVDWLRQRIHPSOR\HHVLVH[SHFWHGWRLQFUHDVHRYHU the medium term, as the programme expects to increase the number of posts to further develop internal capacity for the SURSRVHGUHRSHQLQJRIODQGFODLPVDVFRQWDLQHGLQWKH5HVWLWXWLRQRI/DQG5LJKWV$PHQGPHQW%LOO Risk Management Risk Risk response/mitigation plan Reputational risk linked to delays in settlement of claims Statutory Commission meetings to be held with formal and widespread communication DLPLQFOXGLQJPHGLDDVZHOODVTXDUWHUO\ statistics release Process mapping to be done Communication strategy to be developed Litigation risks Improvement of tracking and management of matters in court Improvement of research 6WDQGDUGLVDWLRQRISURFHVVHVDQGZRUNÀRZ Decision-making centralised and/or standardised work processes Readiness for the reopening of land claims Core team of executive managers leading the process IT systems to support information and project management to be implemented Improved process mapping and shortening of procedures Communication improved before, during and after lodgment +XPDQDQG¿QDQFLDOUHVRXUFHVWREH increased as per plan Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 43 Risk Risk response/mitigation plan Lack of information management system )LQDOLVLQJRIODQGEDVH±8PKODED:HWKX migration &RPSOLDQFHFKHFNOLVWDQGTXDOLW\FRQWUROE\ Quality Assurance Increased Quality Assurance capacity 44 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Programme 5: Land Reform Purpose ,QLWLDWHVXVWDLQDEOHODQGUHIRUPSURJUDPPHVLQ6RXWK$IULFD Programme structure The programme consists of the following subprogrammes: /DQG5HIRUP1DWLRQDO2I¿FH /DQG5HIRUP3URYLQFLDO2I¿FHV Land Reform Grants KwaZulu-Natal Ingonyama Trust Board Communal Land Rights Programme Agricultural Land Holding Account Strategic objectives 7KHWDEOHVEHORZSURYLGHWKHSURJUDPPH¶VVWUDWHJLFREMHFWLYHV 6WUDWHJLF2EMHFWLYH 6WUDWHJLFDOO\ORFDWHGODQGDFTXLUHG 2EMHFWLYHVWDWHPHQW 3URPRWHHTXLWDEOHODQGUHGLVWULEXWLRQDQGDJULFXOWXUDOGHYHORSPHQWE\ DFTXLULQJKHFWDUHVRIVWUDWHJLFDOO\ORFDWHGODQGE\ Baseline 1XPEHURIKHFWDUHVDFTXLUHG$QQXDO5HSRUW -XVWL¿FDWLRQ This strategic objective will ensure that the land allocated for agricultural purposes is used productively and will contribute towards economic GHYHORSPHQWDQGIRRGVHFXULW\ Links /LQNHGWR2XWFRPHDQG6WUDWHJLF*RDO 6WUDWHJLF2EMHFWLYH Farm development support provided to smallholder farmers 2EMHFWLYHVWDWHPHQW Provide comprehensive farm development support to smallholder farmers DQGODQGUHIRUPEHQH¿FLDULHVIRUDJUDULDQWUDQVIRUPDWLRQE\ Baseline New indicator -XVWL¿FDWLRQ This strategic objective will ensure development support to smallholder IDUPHUVDQGODQGUHIRUPEHQH¿FLDULHVIRUDJUDULDQWUDQVIRUPDWLRQ Links /LQNHGWR2XWFRPHDQG6WUDWHJLF*RDO Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 45 6WUDWHJLF2EMHFWLYH Functional systems and institutional arrangements 2EMHFWLYHVWDWHPHQW Functional systems and institutional arrangements for tenure and land administration to enable agrarian reform in all provinces by 2019 Baseline /DQGULJKWVPDQDJHPHQWIDFLOLWLHV -XVWL¿FDWLRQ This strategic objective will ensure fully functional systems and institutional DUUDQJHPHQWVIRUODQGDGPLQLVWUDWLRQ Links /LQNHGWR2XWFRPHDQG6WUDWHJLF*RDO Resource Considerations The spending focus over the medium term will be on the provision of comprehensive farm development support to small- KROGHUIDUPHUVODQGUHIRUPEHQH¿FLDULHVWKHDFTXLVLWLRQRIVWUDWHJLFDOO\ORFDWHGODQGWRLQFUHDVHDFFHVVWRODQGDQGWKH SURGXFWLYHXVHRIVXFKODQG%HWZHHQDQGH[SHQGLWXUHLQWKH/DQG5HIRUP1DWLRQDO2I¿FHDQG/DQG 5HIRUP5HJLRQDO2I¿FHVVXESURJUDPPHVLQFUHDVHGVLJQL¿FDQWO\GXHWRWKHQHHGWRVSHHGXSWKHODQGUHIRUPSURFHVV Over the medium term, expenditure on consultants is expected to decrease, as more internal employees will be able to SHUIRUPWKHGXWLHVSHUIRUPHGE\WKHVHVWUDWHJLFSDUWQHUV 2YHUWKHPHGLXPWHUPKHFWDUHVRIVWUDWHJLFDOO\ORFDWHGODQGZLOOEHDFTXLUHGWKURXJKWKH$JULFXOWXUDO/DQG +ROGLQJ$FFRXQWWRVSHHGXSWKHODQGUHIRUPSURFHVV,QDGGLWLRQIDUPHUVZLOOEHWUDLQHGWKURXJKWKH5$'32YHU WKHPHGLXPWHUPVPDOOKROGHUIDUPHUVZLOOEHVXSSRUWHGDVIURPRQZDUGV7KHUDWLRQDOHEHKLQGWKLVLVWR SURYLGHDJULFXOWXUDOVXSSRUWWRIDUPHUVWRVSHHGXSWKHODQGUHIRUPSURFHVV 7KHSURJUDPPHFXUUHQWO\KDVDIXQGHGHVWDEOLVKPHQWRISRVWVRIZKLFKDUH¿OOHGDQGSRVWVDUH¿OOHGLQ DGGLWLRQWRWKLVHVWDEOLVKPHQW6SHQGLQJRQWKHFRPSHQVDWLRQRIHPSOR\HHVLVH[SHFWHGWRLQFUHDVHDVWKHQXPEHURI SRVWVZLOOEHLQFUHDVHGWRIXUWKHUGHYHORSLQWHUQDOFDSDFLW\LQOLQHZLWKWKHUHVWUXFWXULQJRIWKHODQGUHIRUPSURJUDPPH Risk Management Risk Risk response/mitigation plan Completeness and accuracy of Immovable Assets Register (IAR) 9HUL¿FDWLRQRI,$5DJDLQVWGHHGVUHJLVWU\GDWD Development and review of immovable assets SURFHGXUHVUHVWLWXWLRQDFTXLVLWLRQV FRQ¿UPDWLRQRIYHVWLQJVXEGLYLVLRQV consolidations and disposals) Improvement of tracking and management of matters in court 2 46 Litigation risks Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Implementation of the review outcomes and recommendations of the DPME review on RECAP Risk Risk response/mitigation plan ,QDELOLW\WRDFTXLUHVWUDWHJLFDOO\ORFDWHG ODQGGXHWRLQÀDWLRQRISULFHV Conducting research on market trends and reject prices not linked to comparable sales (VWDEOLVKPHQWRIWKH2I¿FHRIWKH Valuer-General Reputational risk due to a lack of an LQWHJUDWHGEHQH¿FLDU\GDWDEDVH /LDLVLQJZLWKWKHGWLRQWKHLUEHQH¿FLDU\ database with the aim of developing a DRDLR GDWDEDVH Acting CFO has initiated a process of liaising ZLWKWKHGWLRQWKHLUEHQH¿FLDU\GDWDEDVHZLWK WKHDLPRIGHYHORSLQJD'5'/5GDWDEDVH Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 47 PART C: Links to other plans 48 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 19 Public Entities The department is responsible for the following public entities: Name of public entity Mandate Agricultural Land Holding Account The Agricultural Land Holding Account was established in terms of the Provision of Land and Assistance Act $FWRI Section 10(1)(a) gives legal effect to the proactive DFTXLVLWLRQRIODQG where the Minister may, from money appropriated by Parliament for this SXUSRVHDFTXLUH land for the purposes of this DFW7KHUHIRUHWKH state will proactively target land and merge this with the demand or QHHGIRUODQG KwaZulu-Natal Ingonyama Trust Board (ITB) The ITB is established in terms of the provisions of the KwaZulu-Natal Ingonyama Trust Act (Act No 3 of ,WVFRUH business is to manage land for WKHPDWHULDOEHQH¿W and social well being of the individual members of the WULEHV Outputs $FTXLVLWLRQRI strategically located land for agricultural productivity Current annual budget (R ’000) Date of next HYDOXDWLRQ Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 49 Name of public entity Registration of Deeds Trading Account Mandate Outputs To provide an integrated land planning, spatial information and administration system to promote HTXLWDEOH sustainable land use and allocation E\ Improved land administration through professional advisory service for HI¿FLHQWDQG effective surveying and registration of ULJKWVLQODQG Current annual budget (R ’000) 113 194 Date of next HYDOXDWLRQ To provide an integrated land planning, spatial information and administration system to promote HTXLWDEOH sustainable land use and allocation E\ Expedite the registration of rights in land for land reform and UHVWLWXWLRQ 3XEOLF3ULYDWH3DUWQHUVKLSV333V Name of PPP Mandate Project Kgolaganyo To provide fully serviced and DFFHVVLEOHRI¿FH accommodation for WKH1DWLRQDO2I¿FH 50 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Outputs Construction of RI¿FHEXLOGLQJLQ 3UHWRULD Current annual budget (R ’000) 240 000 Date of next HYDOXDWLRQ April 2015 Notes Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 51 Notes 52 Department of Rural Development and Land Reform Strategic Plan 2014 - 2019 Department of Rural Development and Land Reform Private Bag x 833 Pretoria Tel: 012 312 8911 Fax: 012 312 8066 Website: www.ruraldevelopment.gov.za rural development & land reform Department: Rural Development and Land Reform REPUBLIC OF SOUTH AFRICA
© Copyright 2026 ExpyDoc