JOURNAL OF BACTERIOLOGY, Oct. 1993, p. 6260-6268 0021-9193/93/196260-09$02.00/0 Copyright X 1993, American Society for Microbiology Vol. 175, No. 19 Molecular Cloning of a Sporulation-Specific Cell Wall Hydrolase Gene of Bacillus subtilis AKIO KURODA, YASUO ASAMI, AND JUNICHI SEKIGUCHI* Department ofApplied Biology, Faculty of Textile Science and Technology, Shinshu University, 3-15-1 Tokida, Ueda-shi, Nagano 386, Japan Received 24 May 1993/Accepted 27 July 1993 Southern hybridization analysis of Bacillus subtilis 168S chromosomal DNA with a Bacilus licheniformis cell wall hydrolase gene, cwlM, as a probe indicated the presence of a cwlMf homolog in B. subtils. DNA sequencing of the cwLM homologous region showed that a gene encoding a polypeptide of 255 amino acids with a molecular mass of 27,146 Da is located 625 bp upstream and in the opposite direction of spoVJ. The deduced amino acid sequence of this gene (tentatively designated as cwlC) showed an overall identity of 73% with that of cwlM and of 40% with the C-terminal half of the B. subtiUis vegetative autolysin, CwIB. The construction of an in-frame cwlC-lacZ fusion gene in the B. subtils chromosome indicated that cwlC is induced at 6 to 7 h after sporulation (t6 to t7). The spoIHIC (d~") mutation and earlier sporulation mutations greatly reduced the expression of the cwlC-lacZ fusion gene. Northern hybridization analysis using oligonucleotide probes of the cwlC region indicated that a unique cwlC transcript appeared at t7*. and t9. Transcriptional start points determined by primer extension analysis suggested that the -10 region is very similar to the consensus sequence for the oK-dependent promoter. Insertional inactivation of the cwlC gene in the B. subtUis chromosome caused the disappearance of a 31-kDa protein lytic for Micrococcus cell walls, which is mainly located within the cytoplasmic and membrane fractions of cells at t9. The CwIC protein hydrolyzed both B. subtilis vegetative cell walls and spore peptidoglycan. From Bacillus subtilis, two vegetative autolysins, a 50kDa N-acetylmuramoyl-L-alanine amidase (amidase) and a 90-kDa endo-3-N-acetylglucosaminidase (glucosaminidase), have been purified and characterized (16, 38). The former occurs in large amounts (16, 24), and the gene, cwlB, has recently been cloned and studied at the molecular level (24, 29). The cwlB operon consists of three genes encoding a putative lipoprotein (LppX), a modifier protein (CwbA) that stimulates amidase activities, and CwlB, in that order (22, 24, 26, 29). The transcription of the cwlB operon mainly depends on expression of the eD protein, which is responsible for cell motility and chemotaxis (26, 32). Other cell wall hydrolases of B. subtilis have been described previously by us (23) and Foster (11, 12). A 30-kDa amidase gene, cwl4, has been cloned, but its expression is very low under normal growth conditions (11, 23). Foster demonstrated novel cell wall lytic activities of A3 (34-kDa) and A4 (30-kDa), which increases during sporulation, and also sporulation-specific activities of A5 (23-kDa) and A6 (41-kDa) by means of renaturing gel electrophoresis in substrate-containing gels (12). The physiological roles of these multiple autolysins, i.e., cell wall turnover (2, 5), cell separation (5, 10, 37), flagellation (10), and competence (3), have been suggested by many investigators, but there was little evidence because they used regulatory mutants [flaD (sin, lyt) and sacU (Hy)] with reduced autolysin levels (26). Asymmetric septum peptidoglycan hydrolysis (17, 30), which is a morphogenic transition between sporulation stages II and III, cortex maturation (12, 15), mother-cell lysis (12), and germination (12) would be subject to the actions of these autolysins. However, the specific functions of individual autolysins of B. subtilis remained unknown except that vegetative cell wall turnover is apparently decreased in a cwlB(lytC)* deficient mutant (31). Therefore, it is important to determine the roles of individual autolysin genes during growth and differentiation, including their transcriptional regulation. Previously, we cloned the cwlM gene encoding a 28-kDa Bacillus lichenifornis cell wall lytic amidase (27). In this paper, we report the cloning of a sporulation-specific cell wall hydrolase gene, cwlC, of B. subtilis, taking advantage of its homology with cwlM. We also constructed and characterized an in vitro-derived deletion mutant of cwlC. MATERIALS AND METHODS Bacterial strains, phages and plasmids. The strains of B. subtilis used in this study are shown in Table 1. Escherichia coli JM109 [recAI A(lac-proAB) endAI gyrA96 thi-1 hsdR17 supE44 relAI (F':traD36 proAB lacIcZAM15)] (Takara Shuzo Co., Kyoto, Japan) and plasmid pUC119 (Takara Shuzo Co.) were used for cloning, and E. coli JM103 [endA A(lac-proAB) thi strA supE hsdR4 sbcB15 (F':traD36proAB laclVZAM15)] (33) and phages M13mpl8 and M13mpl9 (Takara Shuzo Co.) were used for sequencing. pUD1 (42) contains a chloramphenicol acetyltransferase gene (cat). B. subtilis and E. coli were grown in modified Luria-Bertani medium (5 g of yeast extract, 10 g of polypeptone, 10 g of NaCl per liter [pH 7.2]) at 37°C. When necessary, ampicillin, tetracycline, and chloramphenicol were added to final concentrations of 50, 20, and 10 ,ug/ml, respectively. For B. subtilis sporulation, Schaeffer medium was used (41). Cloning of a cwlM homolog (cwlC) of B. subtilis. PstIdigested fragments of B. subtilis 168S chromosomal DNA were separated by agarose gel electrophoresis, and 5- to 8-kb fragments were recovered from the agarose gels with Geneclean Kit II (Bio 101). Ligation of the DNA fragments into the dephosphorylated PstI site of pUC119 was followed by transformation. Ampicillin-resistant (Apr) transformants were subjected to colony hybridization analysis (40) with the Corresponding author. 6260 VOL. 175, 1993 B. SUBTILIS SPORULATION-SPECIFIC CELL WALL HYDROLASE 6261 TABLE 1. B. subtilis strains used in this study Strain Genotype 168S AC327 AC334 1S38 1S60 1S86 327CL1 327CL2 387CL2 607CL2 867CL2 334CL2 ANC1 trpC2 strA smo-1 purB his-1 smo-1 purB flaDl (sin) trpC2 spoIIIC94 leuB8 tal-1 spoIIG41 trpC2 spoILA1 purB his-1 smo-1 spoVJ::pUDCL1 purB his-1 smo-i cwlC::pUDCL2 his-I smo-1 spoIIIC94 cwlC::pUDCL2 purB smo-1 spoIIG41 cwlC::pUDCL2 purB smo-I spoILU1 cwlC::pUDCL2 purB smo-I flaDi(sin) cwlC::pUDCL2 purB his-I smo-I AcwlC::cat Source or reference 42 42 26 BGSCa BGSC BGSC This study This study 1S38 +327CL2b lS60->327CL2 lS86--327CL2 AC334--327CL2 This study a BGSC, Bacillus Genetic Stock Center, The Ohio State University. b Arrows indicate construction by transformation. 32P-labeled 0.6-kb EcoRI-HindIII fragment of pLA41D1S1R (27) containing a truncated cwlM gene as a probe. From among 200 colonies, a positive clone harboring pCC65P (plasmid pUC119 containing a 6.5-kb PstI fragment) was isolated. A 0.7-kb HindlIl fragment from pCC65P was subcloned into the HindIII site of pUC119, the resultant plasmid being designated pCC07H (Fig. 1A). A 2.4-kb BglIIEcoRV fragment from the B. subtilis chromosome, designated pCC24BE (Fig. 1), was cloned into the BamHI-HincII site of pUC119 with the 32P-labeled 0.7-kb HindIII fragment of pCC07H as a probe. DNA sequencing. Nucleotide sequencing was performed by the dideoxy chain termination method with a modified T7 polymerase (Sequenase; Toyobo). Electrophoresis was performed on 8% (wt/vol) polyacrylamide-8 M urea gels. The sequences of both strands were determined for the 1.1-kb HindIII-EcoRV fragment of pCC24BE and partially for the flanking region (spoVJ), as indicated in Fig. 1A. B. subtUis transformation. Conventional transformation of B. subtilis was performed according to the procedure of Anagnostopoulos and Spizizen (1). Introduction of an in-frame cwlC-acZ fusion gene into the B. subtilis chromosome by Campbell-like recombination. The 1.6-kb NcoI-EcoRI fragment containing the 5' region of cwlC and almost the entire region of spoVJ was isolated from pCC24BE, blunt-ended with mung bean nuclease, and then inserted into the unique SmaI site of pMC1871 (Pharmacia) containing the ,-galactosidase gene (lacZ) (Fig. 1B). The orientation of the insert in one of the resultant plasmids, pMCCZ, containing an in-frame cwlC-lacZ fusion gene was determined from the distance between the asymmetric HindIII site of the insert and the SalI site of the vector and also confirmed by sequencing of its connection site (Fig. 1B). An in-frame spoVJ-lacZ fusion gene was generated through the inverse insertion of this fragment, the plasmid being designated pMCJZ. A 4.6-kb SalI fragment containing the cwlClacZ fusion gene of pMCCZ was inserted into the Sall site of pUD1 (42), and the resultant plasmid was designated pUDCL2 (Fig. 1B). pUDCL2 was then integrated into the B. subtilis AC327 chromosome by means of conventional transformation. The chloramphenicol resistant (Cm') transformant was designated B. subtilis 327CL2. A plasmid, pUDCL1, was constructed by inserting the spoVJ-lacZ translational fusion gene (a 4.6-kb Sall fragment from pMCJZ) into the Sail site of pUD1 and was also integrated into the B. subtilis chromosome. The resultant transformant was desig- nated B. subtlis 327CL1. Campbell-like integration of these plasmids into the B. subtilis chromosome was confirmed by Southern hybridization analysis. Sporulation mutants derived from B. subtils 327CL2 were constructed by conventional transformation and confirmed by the lack of brown pigmentation (Table 1). A 3.3-kb HindIII-SalI fragment containing the cwlC-lacZ translational fusion gene from pMCCZ was inserted into the HindIII-Sall site of pHY300PLK, the resultant plasmid being designated pHY2HS. On the other hand, the 4.6-kb SalI fragment containing the cwlC-lacZ from pMCCZ was inserted into the SalI site of pHY300PLK. The orientation of the insert was determined by checking the distance between the asymmetric HindIII sites of the insert and the vector pHY300PLK. Subsequently, we designated the plasmid pHY2S, in which the orientation of the insert was the same as that in pHY2HS. 1-Galactosidase assay. The P-galactosidase assay was performed basically as described by Shimotsu and Henner (43). B. subtilis cells (1 ml) were centrifuged for 3 min in a microfuge and then stored at -80°C. The frozen cells were suspended in 1 ml of Z buffer (34) containing 300 ,ug of lysozyme per ml and 0.1% (vol/vol) Triton X-100 and then incubated at 30°C for 10 min. The extract was assayed for ,B-galactosidase activity. One unit of ,B-galactosidase activity is defined as the amount of enzyme necessary to increase A420 of 2-nitrophenol released from 2-nitrophenyl-P-D-galactopyranoside (ONPG) by 0.001 in 1 min (34). RNA analysis. RNA preparation and primer extension analysis were performed as described previously (26). The 24-mer oligonucleotide primers, Al (5' TAAAGCGA1TJlG CAGGGTTAACGT 3') and A2 (5' CFl- GTACGATTAT CATTCAACTGA 3'), were complementary to 75 to 98 bp downstream and 44 to 67 bp upstream of the putative translational start point of cwlC, respectively (Fig. 2). The primers were 5' labeled with [_y-32P]ATP (3,000 Ci/mmol; Amersham) and T4 polynucleotide kinase (Takara) according to the manufacturers' instructions. Northern (RNA) blot analysis of RNAs fractionated by electrophoresis in agaroseformaldehyde gels was performed as described by Sambrook et al. (40). Construction of an in vitro-derived deletion mutant. For construction of pBECM containing an insertionally inactivated cwlC gene, pCC24BE was digested with NcoI, bluntended with the Klenow fragment, and then ligated with a 1.1-kb blunt-ended EcoRI-BamHI fragment containing cat J. BAC7ERIOL. KURODA ET AL. 6262 H V H I I I I H N Bg A I4 < I IP- Spores were purified as described previously (10, 24). Crude spore peptidoglycan was prepared basically as described by Warth and Strominger (46). After inactivating spore-bound autolysins by autoclaving (121°C, 30 min), the spores were disrupted with glass beads (diameter, 0.1 mm) in a BeadBeater (Biospec, Bartlesville, Okla.). Spore integuments were sedimented at 20,000 x g for 10 min, washed with 0.2 M sodium phosphate buffer (pH 7.0) and then with deionized water, and digested with trypsin (0.5 mg/ml). The crude spore peptidoglycan was sedimented and suspended in a 4% (wt/vol) sodium dodecyl sulfate (SDS) solution and then boiled for 10 min. After several washes with 1 M NaCl and then deionized water, the cell wall preparation was stored at I- 1 kb -200C. B N/S H Sa pUDCL2 E 4kb a 8. 1 Kb FIG. 1. Restriction map of a cwlM homologous gene (cwlC) of B. subtilis (A) and construction of pCC24BE derivatives (B). (A) Thick arrows indicate the coding regions of the respective genes with their transcriptional direction. Stem-loop structures and thin arrows indicate putative terminators and the sequencing strategy, respectively. The spoVJ gene and its putative terminator are depicted on the basis of the nucleotide sequence data obtained by Foulger and Errington (13). (B) Closed arcs, B. subtilis chromosomal DNA; open arcs, pUC119 or pUC19 DNA; thin arcs, pMC1871 DNA; hatched arcs, fragment containing the chloramphenicol acetyltransferase gene (cat, cm). Abbreviations: Bg, BglII; H, HindIII; N, NcoI; V, EcoRV; Ba, BamHI; E, EcoRI; Hi, HincII; P, PstI; Sm, SmaI; Sa, Preparation of autolysin-containing fractions. B. subtilis AC327 and ANC1 were cultured on Schaeffer medium for 13 h and then sedimented by centrifugation (5,000 x g, 5 min, 40C). Proteins in the culture supernatant (1 ml) were precipitated with trichloroacetic acid (final concentration, 2%) and then centrifuged (12,000 x g, 5 min). After being washed with 70% ethanol, the pellet was dried, resuspended in 40 ,ul of SDS-polyacrylamide gel electrophoresis (PAGE) sample buffer (28), and then boiled for 5 min. A SDS-cell extract was prepared as follows. The cell pellet from 1 ml of culture was directly resuspended in 40 ,ul of the SDS-PAGE sample buffer (28) and then boiled for 5 min. After centrifugation to remove insoluble materials, the supernatant was used as the SDS-cell extract. A protoplast cell extract was prepared as follows. The cell pellet from 40 ml of culture was washed with SMM buffer (42) and then resuspended in 5 ml of SMM buffer containing 1.5 mg of lysozyme (Sigma). After 15 min of incubation at 370C, the protoplasts were sedimented by centrifugation (5,000 x g, 5 min, 4C), washed with 5 ml of SMM buffer, and then suspended in 1.6 ml of the SDS-PAGE sample buffer (28). The extraction was performed as described above. Cell membrane and cytoplasmic fractions were prepared as follows. The protoplast pellet was suspended in 0.8 ml of Z buffer (34) and then disrupted by ultrasonication (Tomy UR-1SOP; 150 W, 4°C, 20 s, twice). After the removal of spores and undisrupted cells by centrifugation (12,000 x g, 5 min, 4°C, two times), cell membranes were sedimented by centrifugation (200,000 x g, 4°C, 20 min). The supernatant was used as the cytoplasmic fraction. Electrophoresis of gels containing the cell wall preparation and renaturation of enzymes were performed as described previously (21). Other methods. Assays for heat and lysozyme resistance of spores were performed as described by Nicholson and Setlow (35). Spore germination was monitored at A580 as described previously (24). Nucleotide sequence accession number. The DDBJ, EMBL, and GenBank accession number for the cwlC sequence is D14666. SalIl. RESULTS (Fig. 1). Then, pBECM was linearized with PstI and used to transform B. subtilis AC327, and Cmr transformants were selected. To examine the predicted recombination, the chromosomal DNA of the transformant was extracted and then subjected to Southern hybridization analysis (40). Preparation of B. subtiis vegetative cell walls and spore peptidoglycan and Micrococcus cell walls. Walls from B. subtilis vegetative cells and Micrococcus luteus ATCC 4698 were prepared essentially as described previously (10, 23). Molecular cloning of a cwlMf homolog of B. subtilis 168S. Previously, we have reported the cloning of the cell wall hydrolase gene, cwlM, from B. licheniformis (27). To determine whether the cwlM homolog is present in the B. subtilis chromosome, Southern hybridization analysis was per- formed with the 32P-labeled 0.6-kb EcoRI-HindIII fragment of pLA41D1S1R (27) as a probe. This fragment contains a truncated cwlM gene whose product retains lytic activity (27). A 6.5-kb PstI fragment of the B. subtilis chromosomal DNA hybridized with the probe under the condition with a VOL. 175, 1993 B. SUBTILIS SPORULATION-SPECIFIC CELL WALL HYDROLASE 6263 1 AAGCTTAAAACCAGCAGGAATCAGTGCAGGTTAACCGAACCCATAGTACATACAAACATATGGCGTATGCACAGATTTCATGTCGGACCGTATCTGTTGT HindI II 101 CGCTTCATGTTGAATTGTGCGCTTTCCCGAGAAATAATTTCTGGATGTGAAAGGGTTATTTCCTCATTTTTCAGTTGAATGATAATCGTACAAGCAGAAG A2 tYIfM V K I F I D P G H G G S D P G A T G N G 201 CCGTGTTTTTTCATATCCTGTAATGAGGTGATGAAAAATGGTTAAAATTTTTATTGATCCTGGCCATGGCGGGTCTGATCCAGGCGCAACAGGTAATGGC SD NcoI Q E K T L T L Q I A L A L R T I L T N E Y E G V S L L L S R T S D 301 CTTCAGGAGAAAACGTTAACCCTGCAAATCGCTTTAGCCTTACGTACGATATTAACTAATGAATATGAAGGCGTTTCTCTGCTGCTGAGCCGGACAAGCG Al L Q Y V S L N D R T N A A N N W G A D F F L S I H V N S G G G T G F 401 ACCAATATGTCAGCTTAAACGACCGGACAAATGCCGCAAATAACTGGGGAGCAGATTTCTTTTTGTCCATTCACGTTAATTCCGGGGGAGGCACAGGTTT E S Y I Y P D V G A P T T T Y Q S T I H S E V I Q A V D F A D R G 501 TGAAAGCTATATTTATCCAGATGTAGGAGCCCCGACGACGACTTATCAATCGACAATTCACTCTGAAGTGATACAAGCTGTCGACTTTGCCGATCGCGGC K K T A N F H V L R E S A M P A L L T E N G F I D T V S D A N K L K 601 AAAAAAACAGCGAACTTCCACGTCCTAAGGGAGTCGGCAATGCCTGCCCTCTTGACCGAGAACGGCTTCATTGATACCGTTTCCGATGCAAATAAGCTGA T S S F I Q S L A R G H A N G L E Q A F N L K K T S S S G L Y K V 701 AAACGAGCAGTTTTATTCAAAGCTTAGCGAGAGGACATGCAAACGGGCTGGAGCAAGCCTTTAACCTTAAAAAGACTTCCAGCTCAGGGTTATATAAGGT HindIII Q I G A F K V K A N A D S L A S N A E A K G F D S I V L L K D G L 801 TCAAATCGGCGCATTTAAAGTCAAAGCGAATGCCGACTCGCTCGCAAGTAATGCCGAAGCCAAAGGTTTTGACTCGATTGTCCTTTTAAAGGACGGATTA Y K V Q I G A F S S K D N A D T L A A R A K N A G F D A I V I L E S 901 TACAAAGTGCAGATTGGCGCATTTTCATCCAAAGACAATGCAGACACCCTCGCTGCCAGAGCGAAAAATGCCGGCTTTGACGCTATTGTGATCCTAGAAT * 1001 CATAGCCGAGACGGGGACGAGCGTCTCATAAAAAAACCCGGCTCTCATCGC_AGAAACCGGGTTTTTTTATTCAAGAATATCAACAACAAACTGTGACC 1101 ATGTTTCCAGACGGTTGTAGATATC EcoRV FIG. 2. Nucleotide sequence of the B. subtilis cwlC gene. Only the sequence of the nontranscribed DNA strand is shown, from position +1 (HindIII site) to +1125 (EcoRV). The deduced amino acid sequence of cwlC (nucleotides 238 to 1,002) is given above the nucleotide sequence. An asterisk indicates a stop codon. A putative ribosome-binding sequence (SD) (nucleotides 225 to 232) and a putative rho-independent terminator sequence (nucleotides 1,028 to 1,072) are indicated. Downward-pointing arrowheads indicate the positions of the 5' termini of cwlC transcripts determined on primer extension analysis (Fig. SB). The nucleotide sequences complementary to synthetic oligonucleotides Al and A2 used in the Northern blot and primer extension experiments are underlined. Foulger and Errington (13) have published the DNA sequence (spoVJ region) which starts from the 75 bp upstream of the HindIII site (position +1). hybridizing solution consisting of 30% formamide, 5 x Denhardt's reagent, 0.5% SDS, and 100 p,g of salmon sperm DNA per ml at 37°C for 18 h (20). The level of the hybridization signal was almost the same as that of the 2.2-kb PstI fragment (cwlMA) of the B. licheniformis chromosomal DNA (20). The 0.7-kb HindIII and 2.4-kb BglIIEcoRV fragments of the B. subtilis chromosomal DNA hybridized with the probe (20). We cloned the 5- to 8-kb PstI fragments into the PstI site of pUC119 and selected the cwlM homolog by means of colony hybridization under the above condition. A positive clone harbored a plasmid (pCC65P) containing a 6.5-kb PstI insert but grew very poorly. Thus, we constructed pCC07H by subcloning a 0.7-kb HindIII fragment from pCC65P into the HindIII site of pUC119 (Fig. 1A). Nucleotide sequencing of the 0.7-kb HindIlI fragment revealed extensive homology with the 3' terminal region of cwlM (20). Furthermore, we cloned the 2.4-kb BglII-EcoRV fragment from the B. subtilis chromosome containing the cwlM homologous gene and its upstream region into the BamHI-HincII site of pUC119 by means of colony hybridization with the 32P-labeled 0.7-kb HindIII fragment of pCC07H as a probe. Two positive transformants grew normally and harbored the same plasmid (pCC24BE) containing the entire cwlM homologous gene (Fig. 1). Nucleotide sequence of the cwlf homolog of B. subtilis. Both strands of the 1.1-kb HindIII-EcoRV region and a part of the 1.2-kb BglII-HindIII region were sequenced (Fig. 1A). Figure 2 shows the nucleotide sequence of the 1.1-kb HindIII-EcoRV region. An open reading frame encoding 255 amino acids with a molecular mass of 27,146 Da is preceded by a typical Shine-Dalgamo sequence (GAGGTGAT, AG = -17.1 kcal (-71.5 kJ)/mol) and followed by a typical p-independent terminator (AG = -28.7 kcal (-120 kJ)/mol). The deduced amino acid sequence showed an overall identity of 73% with that of cwlM (Fig. 3). Therefore, we regarded this open reading frame as a cwlM homologous gene and designated it cwlC. In the C-terminal region of CwlC, there are two intramolecularly repeated sequences (68% identity over 28 amino acids) (Fig. 3). Previously, we suggested that C-terminal repetition of CwlM may be involved in its substrate specificity (27). The N-terminal half of the CwlC protein region exhibits sequence similarity (40% identity over 170 residues) with the C-terminal half (presumed active domain) of the vegetative major autolysin (CwlB protein) of B. subtilis (24) (Fig. 3). The N-terminal region of the CwlC protein shows no typical signal sequence characteristic and is homologous with those of the CwlM and CwlB proteins. Therefore, the N-terminal region of OArlC seems to be essential for its activity. No significant amino acid sequence 6264 J. BACTERIOL. KURODA ET AL. Cw1M 1 MVKIFIDPGHGGSDTGASANGLQEKQLTLQTALALRNMLLNEYQNVSVLLSRTSDQTVS Cw1C 1 MVKIFIDPGHGGSDPGATGNGLQEKTLTLQIALALRTILTNEYEGVSLLLSRTSDQYVS* Cw1B 319 GETIFIDPGHGDQDSGAIGNGLLEKEVNLDIAKRVNTKLNAS--GALPVLSRSNDTFYS Cw1M 60 ** * ******** **** ** ** * * ***** **** ****** ** ************** * ******** ** *** * *** * * ** LTQRTNAANSWGADYFLSIH--- MNAGGGTGFEDYIYPGVGAPTTT-YRDIMHEEILKV * ****** * **** * ***** ******* **** ******* * * Cw1C 60 LNDRTNAANNWGADFFLSIH---VNSGGGTGFESYIYPDVGAPTTT-YQSTIHSEVIQA * * * *A* * **Y***** * * *L * Cw1B 376 LQERVNKAASAQADLFLS IHANANDSSSPNGSETYYDTTYQAANSKRLAEQIQPKLAAN Cw1M 115 VDFRDRGKKTANFHVLRETAMPALLTENGFVDNTNDAEKLKSSAFIQSIARGHANGLAR Cw1C 115 VDFADRGKKTANFHVLRESAMPALLTENGFIDTVSDANKLKTSSFIQSLARGHANGLEQ * Cw1B 435 LGTRDRGVKTAAFYVIKYSKMPSVLVETAFITNASDASKLKQAVYKDKAAQAIHDGTVS Cw1M 174 AFNLSK-NAAALYKVQIGAFRTKANADSLAAQAEAKGFDALVIYRDSLYKVQIGAF-SS * * ********* ** ******* ******** ********* **** * CW1C 174 AFNLKKTSSSGLYKVQIGAFKVKANADSLASNAEAKGFDSIVLLKDGLYKVQIGAF-SS Cw1B 494 YYR SpoIIB 181 Cw1M 231 KENAEALVQQAKNAGFDTFIYQE Cw1C 232 KDNADTLAARAKNAGFDAIVILES SpoIIB 228 KEVSQQLGQVLIDSDFEA *** *********** ************** *** *** * * * ** * * ** * * *Y** *E* * ** *** ** *** * ******** **** * *** *L** * * * YAVQAGKFSNEKGAETLTEQLTEKGYSAVSLSKDDGYTYVIAGLASE * * ** * * ******* * * * FIG. 3. Alignment of the deduced amino acid sequences of the CwlM protein, the CwIC protein, the CwlB protein, and the SpolIB protein. Asterisks indicate identical amino acids. The repeated amino acid sequences in the CwlC and CwlM proteins are indicated by arrows above the sequences. The numbers are the positions with respect to the N-terminal amino acids of CwlM, CwlC, CwlB, and SpolIB. homology was observed between CwlC and CwlA. We found similarity (30% identity over 64 amino acids) between the C-terminal regions of the CwlC and SpoIIB proteins (30) (Fig. 3). The partial nucleotide sequence (937 bp) determined for the 1.2-kb BglII-HindIII region (Fig. IA) was consistent with that of spoVJ (6, 13), except that nucleotide C, which is 93 bp upstream of the translational start codon, was deleted and the 237th codon, AAA, had changed to AAG without an amino acid substitution (20). Consequently, we found that cwlC is located 625 bp upstream of spoVJ in the opposite direction (Fig. 1A). Recently, Fan et al. (9) showed that spoVK (1680 on the genetic map) is identical with spoVJ, and therefore, the map position of cwlC could be assigned as 168°. Expression of the cwlC gene in the wild type and sporulation-deficient strains. To study the expression of the cwlC gene, an in-frame cwlC-lacZ fusion gene (Fig. 1B) was introduced into the B. subtilis chromosome by conventional transformation. Southern hybridization analysis of the resultant transformant indicated the correct integration of the gene into the B. subtilis chromosome (20). Figure 4 shows the time course of expression of the cwlC-lacZ gene. In the parent strain, 327CL2, the fusion gene was not significantly expressed during vegetative growth (less than 4 U of 3-galactosidase activity per unit of optical density at 660 nm (OD6W) of 0.45), but it was induced at 6 to 7 h after the start of sporulation (t6 to t7) (Fig. 4). Phase-bright spores (by phase-contrast microscopy) began to appear in the t6 cells. To study the pattern of dependence of the expression of the cwlC gene on sporulation developmental genes, we constructed a cwlC-lacZ fusion in sporulation-deficient or flaD(sin) mutants (Table 1). The greatly reduced P-galactosidase activities of B. subtilis 387CL2, 607CL2, and 867CL2 indicated that the expression of the cwlC gene requires the 300 0 0 >200 co1 0 100 0 i 15 10 Time after the start of sporulation ( hr ) FIG. 4. Time course of the production of the cwIC-lacZ fusion protein. cwlC-directed ,B-galactosidase activity. was determined at the indicated times after the start of sporulation in the parent strain, B.subtilis 327CL2 (-); sporulation mutants 607CL2 (spoIfiG)(A), 867CL2 (spoIL4) (O), and 387CL2 (spoIIIC) (O); and a flaDI(sin) mutant, 334CL2 (A). The start of sporulation (to) was defined as the point at which cell growth was no longer exponential. B. subtilis 327CL2 exhibited less than 4 U of 0-galactosidase activity per OD6w0 unit at the growing phase (OD6.0 of 0.45). The spoVJ-directed ,B-galactosidase activity was determined in parent strain 327CL1 (A)- VOL. 175, 1993 B. SUBTILIS SPORULATION-SPECIFIC CELL WALL HYDROLASE products of spoIIIC, spoIIG, and spoIL4, respectively. Thus, it is likely that the expression of cwlC is driven by oai (the product of a composite of two truncated genes, spoIVCB and spoIIIC [44]). The requirement for the spoIIG and spoIL4 products for the cwlC expression can be understood as being an indirect consequence of the dependence of o~K expression on the stage II regulatory protein(s). The induction of spoVJ-directed ,B-galactosidase synthesis (327CL1) preceded that of cwlC (Fig. 4). The induction time of spoVJwas not in good agreement with the previous report that the expression of a spoVJ-lacZ fusion became maximum at t4 (13). This may be due to the differences in the sporulation medium and growth conditions (13). The regulatory mutation for vegetative autolysins, the flaDI (sin) mutation (334CL2), did not affect the expression of the cwlC-lacZ fusion (Fig. 4); in contrast, the flaDl(sin) mutation greatly reduced the expression of the cwlB-lacZ translational fusion gene (26). Transcriptional start point(s) of cwlC. To determine the cwlC promoter region, we constructed plasmids pHY2S and pHY2HS, containing about 1.5 and 0.24 kb upstream regions of cwlC, respectively. B. subtilis AC327 harboring pHY2S or pHY2HS was cultured on Schaeffer medium, and P-galactosidase activity was determined as a function of time after sporulation. cwlC-directed 3-galactosidase activity due to the multicopy plasmid was very similar in B. subtilis AC327 (pHY2S) and AC327 (pHY2HS), i.e., the maximum 3-galactosidase activities were 9,000 U per OD6w at tl5 and 7,800 U per OD6. at t16, respectively (20). Thus, we considered the upstream boundaries of cwlC promoter activities to be located inside the HindIlI site (nucleotide 1 in Fig. 2). However, the induction time of the fusion gene in both strains was about 2 h late relative to that of a chromosomal copy of the cwlC-lacZ fusion gene (20). This may be ascribed to the fact that the addition of tetracycline to maintain the multicopy plasmids in cells slightly inhibited the growth rate. We isolated RNA from B. subtilis AC327 at various times after sporulation. The RNA was fractionated by electrophoresis in an agarose-formaldehyde gel, blotted onto a nylon membrane, and then hybridized to oligonucleotide probes. Probe Al hybridized to a transcript which was detected at t7.5 and tg (Fig. 5A). The time of appearance of the cwlC transcript agrees reasonably with that of cwlCdirected 13-galactosidase activity (Fig. 4). No transcript significantly hybridized to probe A2 (20). These results indicated that the cwlC transcript starts from a point between Al and A2. To determine the transcriptional start point(s), we performed extension analysis with primer Al. The Al extension product was subjected to high-resolution gel electrophoresis alongside a dideoxy nucleotide sequencing ladder generated from single-stranded cwlC DNA with Al as a primer (Fig. SB). The -10 (CATATCCTG) region upstream of the start points was very similar to the consensus -10 (CATA---TA) region for r'F-dependent promoters (13, 47, 48) and the consensus -10 (CATACA-T) region for &1-dependent promoters (13, 36). For primer A2, no apparent extension product could be obtained (20). Inactivation of cwlC in the B. subtilis chromosome. We constructed a plasmid, pBECM, containing an insertional inactivated cwlC gene by means of a chloramphenicol acetyltransferase gene (Fig. 1B). The linearized pBECM was used for transformation of B. subtilis AC327. To confirm the inactivation of cwlC, we performed Southern hybridization analysis of chromosomal DNA from one of the Cmr transformants, B. subtilis ANC1, with pCC24BE DNA as a A 12 3 B 4 6265 G A TC 1 2 3 4 .Wc < 23S 4 16s A T T A C 44.- Tw C AA // C/ FIG. 5. Northern blot analysis of cwlC mRNA (A) and determination of transcriptional start sites by primer extension analysis (B). (A) Each lane contains 5 p,g of RNA from B. subtilis AC327 at t4.5 (lane 1), t6 (lane 2), t7 (lane 3), or tg (lane 4). Northern hybridization was performed with AP-5'-end-labeled primer Al, which is complementary to 75 to 98 bp downstream of the putative translational start point of cwlC, as a probe (Fig. 2). Hybridizing RNA is indicated by an arrow. The hybridizing RNA for primer A2 could not be obtained (20). 23S and 16S indicate the positions of the 23S rRNA (2.9 kb) and 16S rRNA (1.6 kb) in the B. subtilis rmB operon, respectively (14). (B) RNA was hybridized with 32P-5'-end-labeled primer Al. Primerextended products obtained with reverse transcriptase were subjected to electrophoresis in a 6% (wt/vol) polyacrylamide sequencing gel and then autoradiography. Dideoxy DNA sequencing reaction mixtures of the cwlC promoter region, with the same primer, were electrophoresed in parallel (lanes G, A, T, and C). Lanes 1 to 4 correspond to RNA (20 ,ug) from AC327 at t4.5, t6, t7.5 and tg, respectively. The positions of the two major products are indicated by arrowheads on the sequence. probe. On HindIII digestion, the two hybridizing bands at 3.2 and 0.7 (overlapping) kb for B. subtilis AC327 and the three bands at 3.2, 1.7, and 0.7 kb for B. subtilis ANC1 indicated the predicted double-crossover integration of the linearized pBECM (20). EcoRI digestion of the chromosomes also supported these results (20). Cell wall hydrolase profile of the cwlC mutant. Figure 6A shows the cell wall hydrolase profile of sporulating cells (tg) of B. subtilis AC327 and ANC1 with the Micrococcus cell wall preparation as a substrate, which is more preferable for the CwlC protein than the B. subtilis vegetative cell walls (20), as well as for the CwlM protein (27). A 31-kDa lytic band corresponding to the CwlC protein was detected for the extract from AC327 protoplasts, but not for that from ANC1 (Fig. 6A, lanes 3 and 4). Since there was an undetectable amount of CwlC protein in the supernatant fraction and a small amount in the SDS-cell extract fraction (Fig. 6A, lanes 2 and 6), the CwlC protein may be located within a cell until its lysis. The membrane and cytoplasmic fractions contain almost the same amount of the CwlC protein (Fig. 6B, lanes 7 and 8). Foster (12) reported that during sporulation, the band A2 (50 kDa), A3 (34 kDa), A4 (30 kDa), and A5 (23 kDa) materials were lytic for B. subtilis vegetative cell walls. But we detected only one lytic band (31 kDa) in this condition, because CwlB (A2) does not lyse Micrococcus cell walls (8, 27), and the A3 and A5 exhibit relatively weak activity (12). When we used gels containing B. subtilis spore peptidoglycan as a substrate, we detected a 31-kDa lytic band corresponding to the CwlC protein of B. subtilis AC327 6266 J. BACrERIOL. KURODA ET AL. A c 4<97k |.4 66k 4 97k 4 97k < 66k | 43k 4 4 3k '431k 4 31k |466k |< 43k -. 31k -422k |422k 4 22k FIG. 6. Cell wall hydrolase profile in a cwlC-deficient mutant. Samples (0.5 or 1 ml) were taken from cultures at tg (A and B) or t4o (C), respectively. Gels contained 0.1% (wt/vol) Micrococcus cell walls (A and B) or 0.2% (wt/vol) B. subtilis spore peptidoglycan (C) as the substrate. After electrophoresis, the proteins were renatured by treatment with 0.1 M Tris-HCl (pH 8.0) and 0.1 M KCI containing 1% Triton X-100 (27). Each gel was stained with 0.1% methylene blue in 0.01% KOH before being photographed. Lanes: 1 and 2, culture supematants at tg; 3 and 4, protoplast extracts; 5 and 6, SDS-cell extracts; 7, membrane fraction; 8, cytoplasmic fraction; 9 and 10, culture supematant at strain ANCL. The molecular masses of the protein t4o. Lanes 2, 4, 6, 7, 8, and 10, B. subtilis AC327; lanes 1, 3, 5, and 9, cwlC-deficient standards (Bio-Rad) are indicated on the right. Rabbit muscle phosphorylase b (97 kDa), bovine serum albumin (66 kDa), hen egg white ovalbumin (43 kDa), bovine carbonic anhydrase (31 kDa), and soybean trypsin inhibitor (22 kDa) were individually stained with Coomassie brilliant blue. Spore peptidoglycan hydrolases (31-kDa CwlC and 33-kDa protein) are indicated by arrows. (Fig. 6C, lane 10). We also found a weak spore peptidoglycan hydrolase (33-kDa protein) (Fig. 6C, lanes 9 and 10). Characterization of the cwlC mutant. The sporulation and germination of B. subtilis AC327 and ANC1 were examined. The sporulation frequencies of AC327 and ANC1 were 77 and 66% at t20, respectively. The heat and lysozyme resistance of spores of ANC1 were also similar to those of AC327 (20). The time course of spore germination monitored atA580 was also similar in both strains (20). The time course of free spore production (mother-cell lysis), monitored by means of phase-contrast microscopy, was also similar in both strains (20). Therefore, the function of the CwlC protein remains obscure. DISCUSSION B. subtilis produces at least four distinct cell wall hydrolases during vegetative growth and, in addition, two during sporulation (12). We previously cloned cell wall hydrolase genes, cwUA (23) and cwlB (24), for B. subtilis and cwlM (27) for B. lichenifonnis. All enzymes encoded by these genes are amidases (21, 24, 27). We show here that a cwlM homolog of B. subtilis (cwlC) is located upstream of the spoVJ gene. Recently, Fan et al. (9) reported the identity of spoVJ to spoVK, which is located at 1680 on the B. subtilis chromosome. The amino acid sequence of CwlC exhibits 73% overall identity with that of CwlM (Fig. 3). Thus, CwlC may be an N-acetylmuramoyl-L-alanine amidase. However, it might remain the possibility that cwlC encodes a regulator. There are amino acid sequence repetitions in the C-terminal region of the CwlC protein (Fig. 3). Such amino acid repetitions have often been observed in the noncatalytic domains of several cell wall hydrolases (4, 24, 27, 39). We have previously reported that the N-terminal to central region of the CwlM protein is a catalytic domain and that the C-terminal repetition may be involved in its substrate specificity, i.e., the CwlM protein hydrolyzes the Micrococcus cell wall preparation more efficiently than those of B. licheniformis and B. subtilis, but the truncated CwlM protein (lacking the C-terminal repetition) has lost this preference (27). In the case of CwlB, there are three repetitions in the N-terminal region which may be involved in the specific and tight binding to the B. subtilis cell wall (24). On the other hand, the C-terminal half of CwlB is a presumed catalytic domain and exhibits 40% identity (over 170 amino acids) with the CwlC protein (Fig. 3), as well as with the CwlM protein (27). The dependence of cwlC-lacZ expression on the spoIIIC gene indicates that the cwlC gene is transcribed by the orK form of RNA polymerase (Fig. 4), which is known to function in the mother cell (18). Recent alignments of oEand oK-dependent promoters revealed consensus for the -35 (kmATATT, where k is G or T and m is A or C) and -10 (CATACA-T) recognition sequences at a spacing of 14 to 15 bp for the e-dependent promoters (13, 36) and consensus for the -35 (AC) and -10 (CATA---TA) at a spacing of 16 to 17 bp for the o-dependent promoters (13, 47, 48), respectively. Interestingly, the consensus sequences for these promoters are rather similar, particularly in the -10 regions. In the' case of cwlC promoter, the -10 region (CATATCCTG) is very similar to the consensus sequences for the &-- and oa'-dependent promoters, but the -35 region (CAAGCAG) found 14 bp upstream from the -10 region does not agree with the consensus sequences. In the -35 region the sequences of A- and oK-dependent promoters are relatively diverse when these promoters require positive regulators, such as SpoIID protein (13, 18, 19, 36) and GerE protein (47, 48). The sequence of the -35 region of the cwlC promoter is very similar to that of cotC (CAAGCCG found 14 bp upstream from the conserved -10 region), of which the transcription with oK RNA polymerase was stimulated in vitro by GerE protein (47). However, it is not known whether the transcription of cwlC requires GerE protein. The cwlC promoter sequence does not show significant homology with promoters recognized by 0G or oF, the ca factors known to function in the forespore (45). The cwlClacZ expression was delayed relative to that of spoVJ-lacZ (Fig. 4). Foulger and Errington have reported that spoVJ expression is driven by dual promoters, P1 and P2, which are under the control of different sigma factors, oE and oa, respectively (13). Since promoter P2 is relatively weak, spoVJ expression is mainly directed by the oF form of RNA polymerase (7, 13). The timing of expression of cwlC-lacZ supports the above idea that the cwlC gene is transcribed by the rK form of RNA polymerase. Previously, Foster described that a 30-kDa lytic protein dramatically increases just prior to mother cell lysis and after cortex synthesis (12). From the similarities of the induction times and molecular masses of this enzyme and the CwlC protein (31 kDa on SDS-PAGE), the two enzymes seem to VOL. 175, 1993 B. SUBTILIS SPORULATION-SPECIFIC CELL WALL HYDROLASE be identical. The insertional inactivation of the chromosomal cwlC gene, which eliminates the 31-kDa lytic protein, did not affect mother-cell lysis, spore germination, or some other spore characteristics. However, some possible functions may be considered. (i) It may cause some subtle change in the peptidoglycan structure that is not detectable on testing of the heat resistance or germination of spores, (ii) its function may become apparent only when cwlA, cwlB, and/or the other cell wall hydrolase gene(s) is inactivated, or (iii) it may play some role in the antimicrobial potentiality of B. subtilis. To examine the compensatory effect, we are now attempting to construct a double or triple mutant for lytic enzymes. Illing and Errington (17) distinguished three substages of sporulation stage II: stage III, in which the asymmetric septation is completed; stage IIij, in which hydrolysis of peptidoglycan from the center of the septum correlates with the bulging of the septum into the mother cell; and stage IIiii, in which hydrolysis of the peptidoglycan extends to the periphery of the septum. We (22, 25) and Lazarevic et al. (29) reported that the product of the spoIID gene, which is required for entry into stage IIiii (17), shows sequence homology with a modifier protein (CwbA). CwbA stimulates cell wall lytic amidases, including the CwlM protein, and therefore, the spoIID product may exhibit stimulatory activity toward some sporulation-specific autolysin(s). Recently, Margolis et al. (30) found that the spoIIB mutation causes a severe block at stage IIj when combined with a mutation in another sporulation gene, spoVG, and interestingly, the C-terminal region of SpolIB shows low but possibly significant similarity to that of CwlM. We also found that the C-terminal repeated region of the CwlC protein (amino acids 186 to 249) shows 30% identity (over 64 amino acids) with that of SpoIlB (amino acids 181 to 245) (Fig. 3). It is conceivable that SpoIIB might directly affect cell wall metabolism at stage II. ACKNOWLEDGMENT We thank N. Sato for technical assistance in the nucleotide sequencing of cwlC. REFERENCES 1. Anagnostopoulos, C., and J. Spizizen. 1961. Requirements for transformation in Bacillus subtilis. J. Bacteriol. 81:741-746. 2. Archibald, A. R. 1989. The Bacillus cell envelope, p. 217-254. In C. R. Harwood (ed.), Bacillus, Plenum Press, New York. 3. Ayusawa, D., Y. Yoneda, K. Yamane, and B. Maruo. 1975. Pleiotropic phenomena in autolytic enzyme(s) content, flagellation, and simultaneous hyperproduction of extracellular a-amylase and protease in a Bacillus subtilis mutant. J. Bacteriol. 124:459-469. 4. Chu, C.-P., R. Kariyama, L. Daneo-Moore, and G. D. Shockman. 1992. Cloning and sequence analysis of the muramidase-2 gene from Enterococcus hirae. J. Bacteriol. 174:1619-1625. 5. Doyle, R. J., and A. L. Koch. 1987. The functions of autolysins in the growth and division of Bacillus subtilis. Crit. Rev. Microbiol. 15:169-222. 6. Errngton, J., and D. Jones. 1987. Cloning in Bacillus subtilis by transfection with bacteriophage vector 4105J27: isolation and preliminary characterization of transducing phages for 23 sporulation loci. J. Gen. Microbiol. 133:493-502. 7. Errington, J., L. Wootten, J. C. Dunkerley, and D. Foulger. 1989. Differential gene expression during sporulation in Bacillus subtilis; regulation of the spoVJ gene. Mol. Microbiol. 3:10531060. 8. Fan, D. P., and M. M. Beckman. 1973. Micrococcus lysodeikticus bacterial walls as a substrate specific for autolytic glycosidase of Bacillus subtilis. J. Bacteriol. 114:804-813. 6267 9. Fan, N., S. Cutting, and R. Losick. 1992. Characterization of the Bacillus subtilis sporulation gene spoVK. J. Bacteriol. 174: 1053-1054. 10. Fein, J. E., and H. J. Rogers. 1976. Autolytic enzyme deficient mutants of Bacillus subtilis 168. J. Bacteriol. 127:1427-1442. 11. Foster, S. J. 1991. Cloning, expression, sequence analysis and biochemical characterization of autolytic amidase of Bacillus subtilis 168 trpC2. J. Gen. Microbiol. 137:1987-1998. 12. Foster, S. J. 1992. Analysis of the autolysins of Bacillus subtilis 168 during vegetative growth and differentiation by using renaturing polyacrylamide gel electrophoresis. J. Bacteriol. 174:464470. 13. Foulger, D., and J. Errington. 1991. Sequential activation of dual promoters by different sigma factors maintains spoVJ expression during successive developmental stages of Bacillus subtilis. Mol. Microbiol. 5:1363-1373. 14. Green, C. J., G. C. Stewart, M. A. Hollis, B. S. Vold, and K. F. Bott. 1985. Nucleotide sequence of the Bacillus subtilis ribosomal RNA operon, rrnB. Gene 37:261-266. 15. Guinand, M., G. Michel, and G. Balassa. 1976. Lytic enzymes in sporulating Bacillus subtilis. Biochem. Biophys. Res. Commun. 68:1287-1293. 16. Herbold, D. R., and L. Glaser. 1975. Bacillus subtilis N-acetylmuramic acid L-alanine amidase. J. Biol. Chem. 250:1676-1682. 17. Iling, N., and J. Errington. 1991. Genetic regulation of morphogenesis in Bacillus subtilis: roles of ar and a' in prespore engulfment. J. Bacteriol. 173:3159-3169. 18. Kroos, L., B. Kunkel, and R. Losick. 1989. Switch protein alters specificity of RNA polymerase containing a compartment-specific sigma factor. Science 243:526-529. 19. Kunkel, B., K. Sandman, S. Panzer, P. Youngman, and R. Losick. 1988. The promoter for a sporulation gene in the spoIVC locus of Bacillus subtilis and its use in studies of temporal and spatial control of gene expression. J. Bacteriol. 170:3513-3522. 20. Kuroda, A., Y. Asami, and J. Sekiguchi. Unpublished data. 21. Kuroda, A., M. Imazeki, and J. Sekiguchi. 1991. Purification and characterization of a cell wall hydrolase encoded by the cwlA gene of Bacillus subtilis. FEMS Microbiol. Lett. 81:9-14. 22. Kuroda, A., M. H. Rashid, and J. Sekiguchi. 1992. Molecular cloning and sequencing of the upstream region of the major Bacillus subtilis autolysin gene: a modifier protein exhibiting sequence homology to the major autolysin and the spoIID product. J. Gen. Microbiol. 138:1067-1076. 23. Kuroda, A., and J. Sekiguchi. 1990. Cloning, sequencing and genetic mapping of a Bacillus subtilis cell wall hydrolase gene. J. Gen. Microbiol. 136:2209-2216. 24. Kuroda, A., and J. Sekiguchi. 1991. Molecular cloning and sequencing of a major Bacillus subtilis autolysin gene. J. Bacteriol. 173:7304-7312. 25. Kuroda, A., and J. Sekiguchi. 1992. Characterization of the Bacillus subtilis CwbA protein which stimulates cell wall lytic amidases. FEMS Microbiol. Lett. 95:109-114. 26. Kuroda, A., and J. Sekiguchi. 1993. High-level transcription of the major Bacillus subtilis autolysin operon depends on expression of the sigma D gene and is affected by a sin(flaD) mutation. J. Bacteriol. 175:795-801. 27. Kuroda, A., Y. Sugimoto, T. Funahashi, and J. Sekiguchi. 1992. Genetic structure, isolation and characterization of a Bacillus lichenifonnis cell wall hydrolase. Mol. Gen. Genet. 234:129137. 28. Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature (London) 227:680-685. 29. Lazarevic, V., P. Margot, B. Soldo, and D. Karamata. 1992. Sequencing and analysis of the Bacillus subtilis IytRABC divergon: a regulatory unit encompassing the structural genes of the N-acetylmuramoyl-L-alanine amidase and its modifier. J. Gen. Microbiol. 138:1949-1961. 30. Margolis, P. S., A. Driks, and R. Losick 1993. Sporulation gene spoIIB from Bacillus subtilis. J. Bacteriol. 175:528-540. 31. Margot, P., and D. Karamata. 1992. Identification of the structural genes for N-acetylmuramoyl-L-alanine amidase and its modifier in Bacillus subtilis 168: inactivation of these genes by 6268 32. 33. 34. 35. 36. 37. 38. 39. 40. KURODA ET AL. insertional mutagenesis has no effect on growth or cell separation. Mol. Gen. Genet. 232:359-366. Marquez, L. M., J. D. Helmann, E. Ferrari, H. M. Parker, G. W. Ordal, and M. J. Chamberlin. 1990. Studies of ePdependent functions in Bacillus subtilis. J. Bacteriol. 172:34353443. Messing, J. 1983. New M13 vectors for cloning. Methods Enzymol. 101:20-78. Miller, J. H. 1972. Experiments in molecular genetics. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. Nicholson, W. L., and P. Setlow. 1990. Sporulation, germination and outgrowth, p. 391-450. In C. R. Harwood and S. M. Cutting (ed.), Molecular biological methods for Bacillus. John Wiley & Sons, Ltd., Chichester, United Kingdom. Roels, S., A. Dnrks, and R. Losick. 1992. Characterization of spolVA, a sporulation gene involved in coat morphogenesis in Bacillus subtilis. J. Bacteriol. 174:575-585. Rogers, H. J., H. R. Perkins, and J. B. Ward. 1980. Microbial cell walls and membranes. Chapman & Hall, Ltd., London. Rogers, H. J., C. Taylor, S. Rayter, and J. B. Ward. 1984. Purification and properties of autolytic endo-3-N-acetylglucosaminidase and the N-acetylmuramyl-L-alanine amidase from Bacillus subtilis strain 168. J. Gen. Microbiol. 130:2395-2402. Romero, A., RI-Lopez, and P. Garcia. 1990. Sequence of the Streptococcus pneumoniae bacteriophage HB-3 amidase reveals high homology with the major host autolysin. J. Bacteriol. 172:5064-5070. Sambrook, J., E. F. Fritsch, and T. Maniatis. 1989. Molecular cloning: a laboratory manual, 2nd ed. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. J. BACTERIOL. 41. Schaeffer, P., J. Millet, and J. P. Aubert. 1965. Catabolite repression of bacterial sporulation. Proc. Natl. Acad. Sci. USA 54:704-711. 42. Sekiguchi, J., B. Eza4i, K Kodama, and T. Akamatsu. 1988. Molecular cloning of a gene affecting the autolysin level and flagellation in Bacillus subtilis. J. Gen. Microbiol. 134:16111621. 43. Shimotsu, H., and D. J. Henner. 1986. Modulation in Bacillus subtilis levansucrase gene expression by sucrose and regulation of the steady-state mRNA level by sacU and sacQ genes. J. Bacteriol. 168:380-388. 44. Stragier, P., B. Kunkel, L. Kroos, and R. Losick. 1989. Chromosomal rearrangement generating a composite gene for a developmental transcription factor. Science 243:507-512. 45. Sun, D., P. Fajardo-Cavazos, M. D. Sussman, F. Tovar-Rojo, R.-M. Cabrera-Martinez, and P. Setlow. 1991. Effect of chro- mosome location of Bacillus subtilis forespore genes on their spo gene dependence and transcription by Ea&: identification of features of good Eau-dependent promoters. J. Bacteriol. 173: 7867-7874. 46. Warth, A. D., and J. L. Strominger. 1969. Structure of the peptidoglycan of bacterial spores: occurrence of the lactam of muramic acid. Proc. Natl. Acad. Sci. USA 64:528-535. 47. Zheng, L., R. Halberg, S. Roels, H. Ichikawa, L. Kroos, and R. Losick 1992. Sporulation regulatory protein GerE from Bacillus subtilis binds to and can activate or repress transcription from promoters for mother-cell-specific genes. J. Mol. Biol. 226: 1037-1050. 48. Zheng, L., and R. Losick. 1990. Cascade regulation of spore coat gene expression in Bacillus subtilis. J. Mol. Biol. 212:645-660.
© Copyright 2026 ExpyDoc