(;+,%,7,216,17(51$7,21$/
DUWLOOXVWUDWHGERRNV
VOOR-$$54SPRING4PRINTEMPS4
5HWRXUHQERHNKDQGHOV5HWRXUVOLEUDLUHV5HWXUQVSROLF\ERRNWUDGH
$OOHDDQNRSHQZRUGHQEHVFKRXZGDOVYDVWHDDQNRRSWHQ]LMDQGHUVRYHUHHQJHNRPHQHQDOVGXVGDQLJYHUPHOGRSGHIDFWXXU
5HWRXUHQ]LMQHQNHOPRJHOLMNQDGULHPDDQGHQHQYRRUPDDQGHQ
5HWRXUHQNXQQHQHQNHOJHEHXUHQQDYRRUDIJDDQGHOLMNHVFKULIWHOLMNHDDQYUDDJ'HUHWRXUWRHODWLQJGLHQWELMGHUHWRXUJHYRHJGWHZRUGHQ
'HUHWRXUJHEHXUWRSULVLFRYDQGHNODQW5HWRXUHQZRUGHQHQNHODDQYDDUGDOV]HRQVLQSHUIHFWHVWDDWEHUHLNHQ%RHNHQPHWSULMVVWLFNHUVRIEHGXLPHOGHH[HPSODUHQNXQQHQQLHWDDQYDDUGRIJHFUHGLWHHUGZRUGHQ
&UHGLWEHGUDJHQZRUGHQLQPLQGHULQJJHEUDFKWYDQQRJWHEHWDOHQVDOGLRIWRHNRPVWLJHDDQNRSHQ
7RXVOHVDFKDWVVRQWFRQGLGpUpVFRPPHDFKDWHQFRPSWHIHUPHVDXIDFFRUGPHQWLRQQpVXUODIDFWXUH
/HVUHWRXUVVRQWSDVSRVVLEOHDYDQWPRLVHWDSUqVPRLV
/HVUHWRXUVGRLYHQWLPSpUDWLYHPHQWrWUHGHPDQGpVDXSUpDODEOHSDUpFULW$SUqVUpFHSWLRQGHO
DFFRUGGHUHWRXUYRXVSRXYH]UHWRXUQHUOHVWLWUHVDFFHSWpVDFFRPSDJQpVGHO
DXWRULVDWLRQGHUHWRXU
&HUHWRXUVHIDLWDX[ULVTXHVHWDX[IUDLVGXFOLHQW6HXOVOHVUHWRXUVDUULYpVGDQVXQpWDWLPSHFFDEOHVHURQWDFFHSWpV
/HVQRWHVGHFUpGLWVHURQWGpGXLWHVGXVROGHHQFRUHjSD\HURXGHVDFKDWVjYHQLU
$OORUGHUVDUHFRQVLGHUHGFRQFOXGHGVDOHVDQGFDQQRWEHUHWXUQHGXQOHVVRWKHUZLVHVWDWHG
5HWXUQVFDQRQO\EHDFFHSWHGDIWHUDZULWWHQUHTXHVWWRRXURIILFHWKHDSSURYDOVKRXOGEHLQFOXGHGLQWKHVKLSPHQW
$OOERRNVPXVWEHLQPLQWFRQGLWLRQ6KRSZRUQRUSULFHVWLFNHUHGERRNVZLOOQRWEHDFFHSWHGRUFUHGLWHG
7LWHOVFDQQRWEHUHWXUQHGEHIRUHGD\VRUDIWHUPRQWKV&UHGLWEDODQFHVDSSO\DJDLQVWIXWXUHSXUFKDVHVRQO\
3ULM]HQWHFKQLVFKHVVSHFLILFDWLHVHQYRRUZDDUGHQNXQQHQZLM]LJHQ]RQGHUYRRUDIJDDQGHZDDUVFKXZLQJ
([KLELWLRQV,QWHUQDWLRQDOLVQLHWYHUDQWZRRUGHOLMNYRRUIRXWHQRIRQWEUHNHQGHJHJHYHQV
9HU]HQGLQJVNRVWHQ]LMQYRRUUHNHQLQJYDQGHNODQW
$OOHEHVFKDGLJLQJHQRIGUXNIRXWHQPRHWHQELQQHQGDJHQQDRQWYDQJVWGRRUJHJHYHQZRUGHQ
'H%HOJLVFKHHQ1HGHUODQGVH>1/@SULM]HQ]LMQLQFO%7:,QWHUQDWLRQDOH>,17@SULM]HQ]LMQH[FO%7:
3ULqUHGHQRWHUTXHOHVSUL[SHXYHQWVDQVQRWLILFDWLRQSUpDODEOHrWUHPRGLILpVSDUGpFLVLRQGHO
pGLWHXURXGHVYDULDWLRQVGHVFRXUVGHFKDQJH
([KLELWLRQV,QWHUQDWLRQDOQHSHXWrWUHWHQXUHVSRQVDEOHSRXUGHVLQGLFDWLRQVHUURQpHVGHSUL[RXGHVGRQQpVPDQTXDQWV
/HVSUL[EHOJHVHWKROODQGDLV>1/@VRQW77&OHVSUL[LQWHUQDWLRQDX[VRQW+7
3ULFHVVSHFLILFDWLRQDQGWHUPDUHVWXEMHFWWRFKDQJHZLWKRXWQRWLFH
([KLELWLRQV,QWHUQDWLRQDOLVQRWUHVSRQVLEOHIRUHUURVDQGRPLVVLRQV
6KLSSLQJFRVWVDUHRQDFFRXQWRIWKHFXVWRPUH$OOGHIHFWVDQGSULQWLQJHUURUVPXVWEHQRWLILHGZLWKLQGD\VRIUHFHSWLRQ
%HOJLDQDQG'XWFK>1/@SULFHVDUHLQFO9$7,QWHUQDWLRQDO>,17@SULFHVDUHH[FO9$7
NEW TITLES SPRING 2014
NIEUWE TITELS VOORJAAR 2014
NOUVEAUTES PRINTEMPS 2014
ANCIENT ART
Francisco de Zurbarán (1598-1664)
Francisco de Zurbarán (1598-1664) est un peintre emblématique de la
période baroque espagnole. Né en Estrémadure, il apprend son métier à
Séville, où il réside la majeure partie de sa vie. En réalisant
d'importantes commandes pour divers ordres religieux, cet interprète de
la Contre-Réforme développe une ouvre d'exception, où la représentation
du sacré mêle la vision extatique des mystiques au réalisme d'une
expérience essentiellement humaine. Après son passage à la cour
madrilène, son style atteint sa pleine maturité dans les commandes
monastiques de la fin des années 30. Par ailleurs, en réponse au goût
contemporain, il exporte ses peintures, dont les fastueuses saintes
martyres produites en série, vers les vice-royautés du Nouveau Monde.
L'artiste finira ses jours à Madrid, où il livre une peinture dévotionnelle
de format plus réduit, de nature plus douce et intimiste. Tenu pour l'un
des plus grands peintres du Siècle d'or espagnol, Zurbarán se distingue
par la rigueur de ses compositions, l'expression fervente du sentiment
religieux, l'ordonnance dépouillée de ses natures mortes et l'attention
portée aux objets du quotidien, dans leur émouvante simplicité.
Zurbarán est à la fois un produit de son époque et un artiste singulier,
dont la puissance du langage plastique exerce une fascination intacte.
Francisco de Zurbarán (1598-1664) is een iconische schilder van de
Spaanse barok. Hij komt uit Extremadura, maar leerde het vak in Sevilla.
Daar bracht hij het grootste deel van zijn leven door. Meer dan één
religieuze orde vertrouwde hem grote opdrachten toe. Zijn uitzonderlijke
oeuvre vertolkt het gedachtegoed van de contrareformatie. Zoals hij het
heilige voorstelt, is er geen scheiding tussen mystieke extase en de
alledaagse menselijke ervaring. Zijn stijl kwam tot volle wasdom in de
monastieke opdrachten van eind jaren 1630, na een verblijf aan het hof
in Madrid. Inspelend op de smaak van zijn tijd exporteerde hij zijn
werken ook naar de Spaanse onderkoninkrijken in de Nieuwe Wereld. Het
ging daarbij onder meer om serieproductie van prachtig uitgedoste
heilige martelaressen. De laatste jaren van zijn leven bracht Zurbarán
door in Madrid. Zijn werken uit deze periode zijn meer op de persoonlijke
devotie gericht en daarom kleiner, zachter en inniger. Strakke
composities, religieuze vurigheid, sober geordende stillevens en aandacht
voor de roerende eenvoud van alledaagse voorwerpen kenmerken het
oeuvre van deze kunstenaar, een van de grootste schilders van Spanjes
Gouden Eeuw. Zurbarán is tegelijk het product van zijn tijd en een zeer
persoonlijk kunstenaar met een plastisch idioom dat nog steeds
fascineert.
[BE] Fonds Mercator/ Mercatorfonds
Expo: 29/1/2014 - 25/5/2014, Bozar, Brussels
[BE] Fonds Mercator/ Mercatorfonds | Hardback | NL ed. & French editions
315 x 235 mm | 272 p | 130 col.ill. |
ISBN: 9789462300354 (NL ed) | ISBN: 9789462300361 (Fr ed) |
€ 49,95 [BE] / € 49,95 [NL] (CB)/ € 47,12 [INT]| Feb. 2014
|
4
ANCIENT ART
Géricault
Fragmenten van mededogen
Images of Life and Death
Gregor Wedekind (Ed.). Essays by B. Chenique,
B. Fornari, C. Quétel, G. Wedekind
In plaats van een klassieke overzichtstentoonstelling werd gekozen
voor bepaalde thema's zoals de menselijke strijd, het gevecht met
de andere evenals met zichzelf, de worsteling om los te komen van
gelijk welke beklemming ook, het portret als ondervraging van de
mens en zijn bestemming en de waanzin als metafoor voor de totale
vrijheid van de geest, die gedoemd is om te worden opgesloten.
Deze onderwerpen worden zowel geduid in het oeuvre van
de kunstenaar als in de geest van zijn tijd.
This beautifully illustrated volume presents the French
Romantic painter Théodore Géricault in a fascinating new light:
through his works that addressed the physical and psychological
torments of contemporary life. It includes four essays by eminent
Géricault scholars.
Expo: 22/2/2014 - 25/05/2014, Museum
voor Schone Kunsten, Gent
[G] Hirmer Verlag | Hardback | NL ed. & Eng. eds |
270 x 220 mm | 224 p | 165 col.ill. | I
SBN: 9783777421476 (NL) | 9783777420684 (Eng)|
€ 39,90 [BE] / € 39,90 [NL] / € 39,90 [INT]|
Feb. 2014
Les Fêtes Galantes
Watteau, Boucher, Fragonard
Sous la direction de Christoph Vogtherr & Mary
Travener Holmes
Les Fêtes galantes mettent en symbiose
plusieurs éléments : décors à la végétation très
luxuriante, tantôt imaginaires, tantôt réels ;
mise en scène du sentiment amoureux par la présence
de danseurs, dames ou bergers idéalisés s'adonnant à
des divertissements de société ou à des confidences.
À cela s'ajoute une recherche d'élégance et de raffinement,
caractéristique de l'esprit rococo du siècle des
Lumières, grâce notamment à l'utilisation
simultanée des lignes courbes et des couleurs claires.
Expo: 14/3/2013 - 21/7/2014,
Musée Jacquemart-André, Paris
[BE] Fonds Mercator/ Mercatorfonds |
Hardback | French ed. | 290 x 240 mm | 240
p | 130 col. & bw ill. | ISBN: 9789462300453 |
€ 44,95 [BE] / € 44,95 [NL]/ € 42,41
[INT]| Feb. 2014
The All-Knowing Buddha
A Secret Guide
Jan van Alphen, a.o.
The set of paintings, what we refer to as the Antwerp album,
forms the core of the current project. While initially they
were thought to represent the life of the Buddha and some
unknown tantric rituals, there is now scholarly
unanimity about the fact that the life of the Buddha is just a
small part of what the album represents. The major part
deals with the meditation on the mandala of Sarvavid
Vairocana, who is the central Buddha in the constellation of the
five Dhyani Buddhas, or Meditation Buddhas.
Expo: Sept 2014 - Feb. 2015, Rubin Art
Museum, New York
[BE] BAI | Hardback | Eng. ed. | 285 x 210 mm |
160 p | throughout col.ill. |
ISBN: 9789085866435 |
€ 29,50 [BE] / € 29,50 [NL] (CB)/ € 29,50 [INT]|
Feb. 2014
5
ANCIENT ART
Disegno & Couleur
Dessins italiens et français du XVIe au
XVIIIe siècle
Expeditie zijderoute
Expedition silk road
Reis naar het westen. Schatten uit de
Hermitage
Journey to the West. Treasures from the
Hermitage
Pavel Lurje, Kira Samosjoek
Pavel Lurje, Kira Samosjoek
Het boek presenteert de zeldzame schoonheid
van vondsten uit verdwenen steden, zoals
muurschilderingen, boeddha's, kostbaarheden
van zijde, zilver, glas, goud en terracotta, die
zijn opgegraven door Russische expedities in
de negentiende en twintigste eeuw. Ontdekkers
die in de voetsporen traden van boeddhistische
monniken, koningen en kooplieden. Nu treedt
de lezer in hun voetsporen en legt zelf de
handelsroutes af, in een reis naar het Westen.
Langs een wereld van onvermoede maar
onvoorstelbaar prachtig
This book presents the rare beauty of finds
from vanished cities: wall paintings, Buddhas
and precious artefacts of silk, silver, glass, gold
and terracotta. All recovered during Russian
archaeological expeditions in the 19th and 20th
centuries. By explorers who trod in the
footsteps of kings, merchants and Buddhist
monks. Now readers can tread in the footsteps
of these archaeological pioneers and follow the
same trade routes to the West. On a journey
through a world of unexpected and
unbelievably splendid
Expo: 1/3/2013 - 5/9/2014, Hermitage
Museum, Amsterdam
[NL] De Nieuwe Kerk - Hermitage | Paperback |
NL & Eng. editions | 280 x 240 mm | 335 p |
ISBN: 9789078653462 (NL ed) |
ISBN: 9789078653479 (Eng. ed)
€ 34,95 [BE] / € 34,95 [NL] (CB)/ € 35,95 [INT]|
March 2014
Cette prestigieuse collection réunit
principalement des dessins de l'école
hollandaise, mais aussi une mosaïque
d'oeuvres graphiques italiennes et françaises
moins connues et étudiées. C'est parmi ces
dernières qu'a été sélectionné un florilège de
dessins d'artistes qui ont travaillé à Florence,
Bologne, Rome, Venise et Paris, les bastions de
l'art de l'époque.
Nederlandse editie: ISBN 9788836623723
Expo: 25/02-18/05/2014,
Disegno & Couleur
Italiaanse en Franse tekeningen van de
16de tot de 18de eeuw
Een uitgelezen selectie met kunstenaars, die
werkzaam waren in de toenmalige artistieke
centra bij uitstek zoals Florence, Bologna,
Genua, Rome, Venetië en Parijs. De keuze
loopt van de 16de tot de 18de eeuw en omvat
vele nooit eerder tentoongestelde bladen, die
door de Koninklijke Musea zijn verworven door
aankoop en schenking zoals de collectie van
Jean de Grez (in 1913) en de collectie van Alla
en Bénédict Goldschmidt (in 1990).
Expo: 25/02-18/05/2014, Koninklijke
Musea voor Schone Kunsten van België /
Musées Royaux des Beaux Arts de Belgique,
Brussels
[IT] Silvana | Paperback with flaps | NL ed. |
297 x 240 mm | 256 p | 300 col.ill. |
ISBN: 9788836623723 (NL ed) |
ISBN: 9788836623716 (Fr ed) |
€ 34,00 [BE] / € 35,95 [NL]/ € 34,00 [INT]|
Dec. 2012
Velázquez: Las Meninas and the
Late Royal Portraits
Javier Portús Perez
This book presents a complete survey of one of
the key moments in the history of the Spanish
court portrait, a period spanning the years
1650 to 1680. In 1650 Velázquez was in Rome,
where he depicted members of the papal court
with a new freedom of approach, while the
following year saw his keenly awaited return to
Spain, where he returned to the conventions of
the court portrait.
Expo: 8/10/13 - 9/2/2014, Museo
Nacional del Prado, Madrid
[UK] T & H | Hardback | Eng. ed. | 310 x 270
mm | 176 p | 83 col.ill. | 9 bw ill. | ISBN:
9780500970584 | € 51,50 [BE] / € 51,50 [NL]
/ € 51,50 [INT] | Jan. 2014
6
ANCIENT ART
Paolo Veronese
Dutch & Flemish Drawings
Chiaroscuro Woodcuts
Alessandra Zamperini
At the Victoria and Albert Museum
Masterpieces of Renaissance Printmaking
Here is a glorious survey of the work of Paolo
Veronese (15281588), one of the most prolific
and successful painters of the Italian late
Renaissance. Together with Titian and
Tintoretto, he is associated with some of the
greatest Venetian art of the 16th century.
Known for his enormous feast scenes, frescoes
and ceiling paintings, Veronese refined the use
of colour to enhance his illusionistic effects: he
has been called the greatest colourist who ever
lived.
Expo: 19/3/2014 - 15/6/2014, National
Gallery, London
The V&A's collection of over 800 Dutch and
Flemish sheets, made between the fifteenth
and the end of the nineteenth centuries, is the
largest in England after that of the British
Museum. It includes masterpieces by
Rembrandt, Rubens and Van Dyck, as well as
designs for tapestries, stained glass and prints,
and portraits and topographical views. This
systematic catalogue presents 7 years of
research by two of the leading authorities in
this field. It also includes an essay on the
history of the collection.
During the sixteenth century a revolutionary
printing process was developed in Northern
Europe, allowing artists to produce colour
effects never before seen in printed media. The
chiaroscuro woodcut added tonal blocks to the
black line block to create the interplay of light
and dark chiaroscuro the word that came to
define the technique. This beautiful volume
brings together 120 masterpieces of the
chiaroscuro woodcut technique, examining the
fascinating history of the medium and showing
its spread.
Expo: 15/3/2014 - 8/6/2014, Royal
Academy, London
[UK] T & H | Hardback | Eng. ed. | 326 x 270
mm | 352 p | 300 col. & bw ill. | ISBN:
9780500093832 | € 87,50 [BE] / € 87,50 [NL]
/ € 87,50 [INT]| March 2014
[UK] V & A Museum | Set of 2 hardback
Volumes | Eng. ed. | 287 x 247 mm | 320 p |
1000 col.ill. | ISBN: 9781851777877 | €
275,00 [BE] / € 275,00 [NL] / € 275,00
[INT]| June 2014 [firm only]
[UK] Royal Academy | Hardback | Eng. ed. |
210 x 150 mm | 224 p | ISBN:
9781907533631 | € 58,50 [BE] / € 58,50 [NL]
/ € 58,50 [INT]| March 2014
Leonardo Da Vinci: Anatomist
The Hermitage
250 Masterpieces
Introduction by Mikhail Borisovich Piotrovsky
For 250 years the State Hermitage has been
one of Europe's most palatial museums. The
Hermitage collections were developed
beginning in 1764 by Catherine the Great,
Empress of Russia, and now encompass more
than three million works of art and artifacts
displayed within a spectacular architectural
ensemble, the heart of which is the famed
Winter Palace.
/
[US] Rizzoli | Hardback | Eng. ed. | 247 x 222
mm | 272 p | 300 col.ill. | ISBN:
9780847842094 | € 46,50 [BE] / € 46,50 [NL]
€ 46,50 [INT]| April 2014
7
Leonardo daVinci was one of the greatest
anatomists ever to have lived. He dissected
more than thirty human corpses in order to
explore every aspect of anatomy and
physiology. His findings are recorded in
drawings of unparalleled beauty and lucidity,
as well as in notes that bear witness to his
astonishing insights into the subject. This book
presents 87 of the finest of these documents
the largest showing of Leonardos anatomical
studies there has ever been with a full
discussion of their anatomical content
[UK] Royal Collection | Paperback | Eng. ed. |
250 x 210 mm | 256 p | 120 col.ill. | ISBN:
9781909741034 | € 27,95 [BE] / € 27,95 [NL]
/ € 27,95 [INT]| Jan. 2014
Now in paperback
ART HISTORY
Expo: 19/3/2014 - 1/9/2014, Museum M, Leuven
Met GRATIS ticket voor de tentoonstelling !,
Ticket d'entrée pour l'expo inclus
Ravage
Ravage
Kunst en Cultuur in tijden van conflict
Art et culture en période de conflit
Onder leiding van Jo Tollebeek & Eline Van Assche
Sous la direction de Jo Tollebeek & Eline Van Assche
In 2014 organiseert M - Museum een tentoonstelling met als centraal
thema het lot van het artistieke en culturele erfgoed in tijden van
conflict. De herdenking van het uitbreken van de Eerste Wereldoorlog en
de brand van de universiteitsbibliotheek van Leuven in 1914 vormen
hiervoor een uitstekend uitgangspunt. De gebeurtenissen in Leuven zijn
de perfecte illustratie van het feit dat cultuurgoederen, al evenzeer als
soldaten en onschuldige burgers, in tijden van conflict het slachtoffer van
het oorlogsgeweld worden.
Zo speelden, nog lang voor de Eerste Wereldoorlog, vernielde steden,
beschadigde gebouwen en monumenten, gestolen kunstwerken en
boekverbrandingen een dramatische rol in conflictperiodes. Ook vandaag
nog blijven misdaden tegen de kunst meer dan ooit een realiteit. Daarom
wil deze tentoonstelling de bespiegelingen van hedendaagse kunstenaars
confronteren met die van kunstenaars uit het verleden.
Ook vandaag nog blijven misdaden tegen de kunst meer dan ooit een
realiteit. Het werk wil de impact van gewapende conflicten op het
artistieke werelderfgoed volgen, vanaf de Trojaanse Oorlog tot de
recente conflicten in het Midden-Oosten. Zo kunnen bespiegelingen van
hedendaagse kunstenaars worden geconfronteerd met die van
kunstenaars uit het verleden.
En 2014, le M Museum propose une exposition avec pour thème central
le sort du patrimoine artistique et culturel en période de conflit. La
commémoration du début de la Première Guerre mondiale ainsi que
l'incendie de la bibliothèque universitaire de Louvain en été 1914, s'y
prêtent particulièrement. Les évènements de Louvain illustrent
parfaitement le fait qu'en période de conflit, les biens culturels, tout
autant que les soldats et les innocents citoyens, souffrent de la violence
belliqueuse.
Ainsi, même bien avant la Première Guerre mondiale, les villes
dévastées, les bâtiments et monuments dégradés, les oeuvres d'art
pillées et les autodafés de livres jouaient un rôle dramatique en période
de conflit. Aujourd'hui, les crimes contre l'art restent, plus que jamais,
une réalité. De ce fait, cette exposition se propose de mettre en présence
les réflexions d'artistes contemporains et d'artistes du passé.
[BE] Fonds Mercator/ Mercatorfonds | Hardback | Dutch (NL), French
and Eng. editions | ed. | 305 x 255 mm | 352 p | 230 col. & bw ill. |
ISBN: 9789462300422 (NL ed)|
ISBN: 9789462300439 (Fr.ed)
ISBN: 9789462300446 (Eng. ed)
€ 59,95 [BE] / € 59,95 [NL] (CB)/ € 56,56 [INT]|
March 2014
8
ARCHAEOLOGY
The Viking Ship
Gareth Williams
In the ninth and tenth centuries, the Vikings
created an unrivalled cultural network that
spanned four continents. Adventurers, farmers,
traders, conquerors and sailors, the Vikings
were both peaceful and fierce, fighting or
bargaining their way through as far as
Constantinople in the East, North America and
Greenland in the North, the British Isles in the
West as well as into the Mediterranean.
This beautifully illustrated book explores the
core period of the Viking Age.
Expo: 06/03/2014 - 22/06/2014, British
Museum, London
The Viking ship is one of the most iconic
images of the Viking Age. As well as including
well-known vessels such as the spectacular
ship-burials from Gokstad and Oseberg in
southern Norway, Viking Ships introduces the
newly-conserved Roskilde 6 ship from
Denmark. Measuring at over 37 metres, this is
the longest Viking ship ever discovered and will
form the core of the touring exhibition Vikings:
life and legend.. This book will explore the
evolution of their sea-going vessels.
[UK] British Museum | Paperback | Eng. ed. ,
289 x 245 mm | 288 p | 320 col.ill. | 320 col.
& bw ill | ISBN: 9780714123370 | € 36,50
[BE] / € 36,50 [NL] / € 36,50 [INT]| Feb. 2014
[UK] British Museum | Paperback | Eng. ed. |
190 x 170 mm | 96 p | 50 col.ill. | ISBN:
9780714123400 | € 14,50 [BE] / € 14,50 [NL]
/ € 14,50 [INT]| Feb. 2014
Runes
Le bivouac de Napoléon
Ancient Lives, New Discoveries
Martin Findell
Ce sont autant d'éléments de campement
(utilisés pour le coucher, le repas, la toilette ou
encore le travail), d'éléments de contexte et de
connaissances (documents d'archives ou
brevets d'inventions) ou encore de documents
iconographiques et oeuvres picturales (dont 5
grands tableaux d'histoire de Mongin, Lejeune
ou encore Roehn) qui offriront dans cet
ouvrage une vision la plus complète possible de
la vie des bivouacs de Napoléon, les soirs de
victoire comme de défaite.
Expo : 13/02/14 - 12/05/14, Palais Fesch
- Musée des Beaux Arts, Ajaccio
The Science of Mummies
Vikings
Life and Legend
Gareth Williams & Peter Pentz
From late antiquity through to the early middle
ages, people across north-western Europe were
inscribing runes on a range of different objects.
Once identified and interpreted by experts,
runes provide us with invaluable evidence for
the early Germanic languages including
English, Dutch, German and the Scandinavian
languages and reveal a wealth of information
about our early civilisations. Runes employ
many techniques from informal scratchings to
sophisticated inlaid designs or exquisite relief
carvings.
[UK] British Museum | Paperback with flaps |
Eng. ed. , 210 x 147 mm | 112 p | 30 col.ill. |
30 col. & bw ill | ISBN: 9780714180298 | €
14,50 [BE] / € 14,50 [NL] / € 14,50 [INT]|
Feb. 2014
[IT] Silvana | Paperback | French ed. | 280 x
220 mm | 120 p | 80 col.ill. | ISBN:
9788836628032 | € 15,00 [BE] / € 15,90 [NL]
/ € 15,00 [INT]| Jan. 2013
9
John H. Taylor, Daniel Antoine
In recent years, British Museum curators have
collaborated with scientists and medical
experts to explore non-invasive imaging
techniques and other scientific approaches to
further study Egyptian mummies. Piecing
together key biographical data and
information, it has been possible for the first
time to discover more about who these people
were in ancient Egyptian society. Eight
significant mummies are explored, each
carefully selected to tell a different story,
covering a period of over 4000 years.
Expo: 22/05/2014 - 30/11/2014, British
Museum, London
[UK] British Museum | Paperback | Eng. ed. ,
254 x 228 mm | 112 p | 225 col.ill. | 225 col.
& bw ill | ISBN: 9780714119120 | € 24,95
[BE] / € 24,95 [NL] / € 24,95 [INT]| May 2014
ART HISTORY
Illusion Confusion
L'art belge entre rêves et réalités
The Wonderful World of Optical Deception
Chefs d'oeuvres du musée d'Ixelles
This comprehensive survey of optical illusions
includes an astonishing range of images from
ancient times to the present. Covering illusions
of depth, inversions, vibration effects,
ambiguous figures, camouflage, anamorphic
art, tessellations and other brain-teasing
illusions, it presents examples from
psychology, the popular press, the decorative
arts, contemporary street art and the fine arts.
M. C. Escher, Picasso, Vasarely, Magritte, Liu
Bolin, Jos de Mey and other artists are
generously represented.
Le thème retenu pour cette exposition
itinérante entre la Suisse et la France est un
panorama de l'art belge des 150 dernières années,
à travers la présentation des principales tendances
de son histoire. Avec des oeuvres de Pierre Alechinsky,
Paul Delvaux, James Ensor, Jan Fabre, René Magritte,
Théo van Rysselberghe, e.a.
Organisé en sections thématiques destinées, ce
parcours permettra de découvrir les épisodes
majeurs.
Expo: 8/3/2014 - 1/6/2014, Musée des
Beaux arts de La Chaux-de-Fonds et de
Juin à Oct. 2014 au Espace Bellevue de
Biarritz
[UK] T & H | Paperback | Eng. ed. | 220 x
220 mm | 320 p | ISBN: 9780500291313 |
€ 27,50 [BE] / € 27,50 [NL] / € 27,50 [INT]|
Feb. 2014
Jean Dypréau
Le point de vision. Ecrits sur l'art
Les écrits de Jean Dypréau ont été rassemblés
et transcrits par Simon Delobel
Le Point de vision réunit tous les écrits
critiques sur l'art de Jean Dypréau (1917 1986) - car il était aussi aussi poète et peintre
- publiés au cours de son existence sur de
multiples supports, de modestes brochures à
des livres luxueux, sans oublier les très
nombreux catalogues d'exposition auxquels il
contribua généreusement.
Expo: 14/03/2014 - 06/07/2014
[IT] Silvana | Paperback with flaps | French
ed. | 240 x 230 mm | 176 p | 100 col. & bw
ill. | ISBN: 9788836628186 | € 25,00 [BE] /
€ 26,50 [NL] / € 25,00 [INT]| March 2013
50 Art Movements You Should
Know
Rosalind Ormiston
The latest volume in this beautifully produced
and affordable series introduces readers to the
major developments in the history of modern
art from Realism to the New Leipzig School.
[UK] Prestel | Flexi (Pb luxe) | Eng. ed. |
240 x 193 mm | 144 p | 100 col.ill. |
ISBN: 9783791348803 |
€ 21,00 [BE] / € 21,00 [NL] / € 21,00 [INT]|
April 2014
[BE] Editions Marot | Hardback | French ed. |
240 x 165 mm | 512 p | several bw ill. | ISBN:
9782930117256 | € 38,95 [BE] / € 38,95
[NL] / € 36,75 [INT]| Oct. 2013
10
MODERN ART
Michel Seuphor
Sergio Servellon
Michel Seuphor (pseudoniem van
Fernand-Louis Berckelaers, Antwerpen, 1901Parijs, 1999) is één van de sleutelfiguren uit de
kunstscène van het interbellum. Naast zijn
literair oeuvre bouwde hij tevens een
aanzienlijke carriere als beeldend kunstenaar.
Het FeliXart Museum brengt een overzicht van
zijn plastisch werk, dat naast tekeningen,
collages en assemblages, ook uit toegepaste
kunst bestaat, opnieuw onder de aandacht.
Expo: 17/11/2013 - 09/03/2014, FelixArt
Museum, Drogenbos
[BE] Pandora | Hardback | E/ F/ NL/ G ed. |
240 x 240 mm | 288 p | throughout col.ill. |
ISBN: 9789053253687 | € 39,00 [BE] / €
39,00 [NL] (CB)/ € 36,79 [INT]| Feb. 2014
Redécouverte du Surréalisme Herontdekking van het
Surrealisme
André Garitte
In deze publicatie komen het surrealisme en
zijn uitlopers aan bod. Het surrealisme wordt in
deze publicatie benaderd vanuit de
surrealistische kunstenaars als aparte figuren.
In deze publicatie komt werk aan bod van o.a.
René Magritte, Paul Delvaux, Felix Labisse,
Marcel Mariën, ELT Mesens, Pol Bury, Rachel
Baes,...
Expo: 22/2/2014 - 14/9/2014, Huis
Magritte, Jette
[BE] Pandora | Hardback | NL/ Fr ed. | 297 x
245 mm | 160 p | throughout col.ill. | ISBN:
9789053253694 | € 34,95 [BE] / € 34,95 [NL]
/ € 37,10 [INT]| Feb. 2014
Eugeen Van Mieghem
Jef Van Grieken
1875-1930 Antwerpen
De zuivere lijn / La ligne pure / The clear
line. Catalogue raisonné
Erwin Joos
De laatste jaren wordt het werk van de
Antwerpse havenkunstenaar Van Mieghem
internationaal herontdekt door
tentoonstellingen o.a. in Barcelona, Londen,
New York, Parijs, Amsterdam en Berlijn. Dit is
mede te danken aan auteur en conservator
Erwin Joos van het Eugeen Van Mieghem
Museum in Antwerpen die sinds '82 het oeuvre
bestudeert. Dit is zijn eerste boek gewijd aan
de grootste Van Mieghem collectie ter wereld:
het Stedelijk Prentenkabinet van Antwerpen
dat niet dan 610 werken van deze kunstenaar
bezit.
In deze overzichtscatalogus wordt een oeuvre
getoond dat zich ontvouwt in grafisch
raffinement. Bovendien staan alle etsen en
ex-librissen er in afgebeeld die Jef Van Grieken
vanaf 1972 tot nu heeft gerealiseerd.
Expo: March 2014 - May 2014, Museum
Jacob Smits, Mol
[BE] Pandora | Hardback | Eng./ Fr./ NL ed. |
280 x 240 mm | 192 p | 330 col.ill. | ISBN:
9789053253588 | € 49,00 [BE] / € 49,00 [NL]
/ € 49,00 [INT]| Oct. 2013
[BE] BAI | Hardback | NL ed. | 280 x 220 mm
| 272 p | 460 col.ill. | ISBN: 9789085864721 |
€ 29,95 [BE] / € 31,75 [NL] / € 29,95
[INT]| Feb. 2014
Herdruk
11
MODERN ART
Brancusi, Rosso, Man Ray
Framing Sculpture
Peter van der Coelen, Francesco Stocchi
In een tentoonstelling waarin de relatie tussen
beeldhouwkunst en fotografie centraal staat,
brengt Museum Boijmans Van Beuningen werk
samen van drie internationale kunstenaars die
bepalend zijn geweest voor de ontwikkeling
van de artistieke praktijk in de 20ste eeuw:
Medardo Rosso (1858-1928), Constantin
Brancusi (1876-1957) en Man Ray
(1890-1976).
Expo: 8/2/2014 - 11/5/2014, Museum
Boijmans van Beuningen, Rotterdam
[NL] Boijmans van Beuningen | Paperback |
Dutch (NL) & Eng. eds. | 230 x 170 mm | 256 p |
ISBN 9789069182698 (NL) | ISBN: 9789069182704 (Eng)
| € 34,95 [BE] / € 34,95 [NL] / € 33,96 [INT]| Feb. 2014
Odilon Redon
L'oeil d'un collectionneur
Arsenii Tarkovsky: Poems
Raphael Bouvier, Margret Stuffmann, Jodi
Hauptman
Redon et Denis : Rêve, amour, sacré
Artistic Kinship between Arsenii and
Andrei Tarkovsky
Odilon Redon's fantastic imagery, evoking the
workings of the unconscious mind, has often
seemed to be more closely aligned with the art
of the 20th century than that of the 19th. Yet
his highly symbolic visions of a dreamlike world
have remained enigmatic and frequently
misunderstood. This book explores Redon's life
and work in full detail. Re-shaping our
understanding of this intriguing artist and his
career, seven prominent experts place Redon
in the context of his own time.
Expo: 2/2/2014 - 18/5/2014, Fondation
Beyeler, Riehen/ Basel
[G] Hatje Cantz | Hardback | Eng. ed. | 312 x
254 mm | 176 p | 125 col. & bw ill. | ISBN:
9783775737531 | € 49,80 [BE] / € 49,80 [NL]
/ € 49,80 [INT]| Feb. 2014
En 1896, Ambroise Vollard le célèbre marchand
parisien de Cézanne, des impressionnistes et
des nabis lance l'exposition « Les peintres
graveurs » pour laquelle Bonnard conçoit
l'affiche. Elle réunira l'ensemble des peintres
nabis autour de leur passion de l'estampe.
Aujourd'hui l'occasion est donnée, grâce à
cette exceptionnelle collection privée choisi par
le musée Bonnard, de dévoiler combien
l'estampe fait partie intégrante du «
programme» de chacun de ces artistes.
Expo : 15/03/01-4-15/06/14, Musée
Bonnard
[IT] Silvana | Paperback | French ed. | 270 x
220 mm | 192 p | 150 col.ill. | ISBN:
9788836627813 | € 28,00 [BE] / € 29,95 [NL]
/ € 28,00 [INT]| Jan. 2013
12
Kitty Hunter Blair
Andrei Tarkovsky is widely regarded as one of
the most significant filmmakers of modern
times. Fundamental to his practice are the
poems that his father, Arsenii, created. They
resonate through many of the films, and offer
levels of meaning which lie undetected to the
unknowing eye. For the first time this book
presents not only accurate and beautiful
renditions of these poems in English, but also a
penetrating and illuminating presentation of
the dynamic creative relationship between
father and son .
[UK] Tate | Paperback | Eng. ed. | 215 x 163
mm | 240 p | 40 col. & bw ill. | ISBN:
9781849762496 | € 23,95 [BE] / € 23,95 [NL]
/ € 22,80 [INT]| May 2014
MODERN ART
Andrew Wyeth
Looking Out, Looking In
Nancy Anderson and Charles Brock
Gauguin
Metamorphoses
Starr Figura, Elizabeth Childs
This volume explores the remarkable
relationship between Paul Gauguins rare and
extraordinary prints and transfer drawings, and
his better-known paintings and sculptures in
wood and ceramic. Richly illustrated with
approximately 190 works in a range of
mediums. It explores the artists radically
experimental approach to techniques and his
pivotal place in the history of art.
Expo: 8/3/2014 - 8/6/2014, M.O.M.A.,
New York
[UK] T & H, Distributed | Hardback | Eng. ed.
| 270 x 230 mm | 264 p | 233 col.ill. | ISBN:
9780870709050 | € 55,00 [BE] / € 55,00 [NL]
/ € 55,00 [INT]| Feb. 2014
Edgar Degas
Drawings and Pastels
Edgar Degas (1834-1917) was described as
'the most intelligent, the most demanding, the
most merciless draughtsman in the world' by
the poet and critic Paul Valéry. Through an
examination of the artist's drawings and
pastels, which exist in great number and
variety, Christopher Lloyd examines the
development of Degas's style and outlines the
story of his life in the contexts of
Impressionism and Post-Impressionism.
[UK] T & H | Hardback | Eng. ed. | 229 x 152
mm | 320 p | 238 col. & bw ill. | ISBN:
9780500093818 | € 36,50 [BE] / € 36,50 [NL]
/ € 36,50 [INT]| April 2014
13
One of Andrew Wyeth's most important
paintings, Wind from the Sea, a recent gift to
the National Gallery of Art, is also the artist's
first full realization of the window as a
recurring subject in his art. Wyeth returned to
windows over the next sixty years, producing
more than 250 works that explore both the
formal and conceptual richness of the subject.
Spare, elegant and abstract, these paintings
are free of the narrative element inevitably
associated with Wyeth's better-known figural
compositions.
Expo: 11/5/2014 - 30/11/2014, National
Gallery of Art, Washington. Published by
D.A.P.
[UK] T & H, Distributed | Hardback | Eng. ed.
| 279 x 229 mm | 224 p | 150 col.ill. | ISBN:
9781938922190 | € 51,50 [BE] / € 51,50 [NL]
/ € 51,50 [INT]| May 2014
MODERN ART
Henri Matisse
Richard Hamilton
Malevich
The Cut-Outs
Edited by Mark Godfrey, Paul Schimmel and
Vicente Todoli
Edited by Achim Borchardt-Hume
Edited by Karl Buchberg, Nicholas Cullinan and
Jodi Hauptman
Henri Matisse (1869-1954) is one of the
leading figures of modern art. His unparalleled
cut-outs are among the most significant of any
artist's late works. When ill health first
prevented Matisse from painting, he began to
cut into painted paper with scissors as his
primary technique to make maquettes for a
number of commissions, from books and
stained-glass window designs to tapestries and
ceramics.
Expo: 17/4/2014 - 7/9/2014,
Tate Modern, London
[UK] Tate | Paperback | Eng. ed. | 270 x 225
mm | 256 p | 200 col.ill. | ISBN:
9781849761307 | € 35,95 [BE] / € 35,95 [NL]
(CB)/ € 33,95 [INT]| April 2014
This publication presents the first retrospective
to encompass the full scope of Hamilton's
work, from his early exhibition designs of the
1950s to his final paintings of 2011, exploring
his relationship to design, painting,
photography and television, as well as his
engagement and collaborations with other
artists.
Hamilton is best known for his pivotal role in
the birth of pop art. The book will also
showcase the wider contemporary issues and
political subjects in Hamilton's work.
Expo: 13/2/2014 - 26/5/2014, Tate
Modern, London_
Reina Sofia, Madrid
[UK] Tate | Paperback | Eng. ed. | 320 x 240
mm | 352 p | 250 col.ill. | ISBN:
9781849762595 | € 42,95 [BE] / € 42,95 [NL]
(CB)/ € 40,50 [INT]| Feb. 2014
14
Russian-born Kazimir Malevich (1879-1935)
was Russia's most influential avant-garde
artist, a key figure in a succession of art
movements in the early twentieth century. His
style of severe geometric abstraction, which he
called suprematism, was a precursor to the
development of constructivism. This publication
accompanies a unique retrospective of one of
the founders of abstract art. The exhibition is
unprecedented in its scope, and sheds new
light on Malevich's career as a painter,
printmaker and teacher.
Expo: 16/7/2014 - 19/10/2014, Tate Modern, London
[UK] Tate | Paperback | Eng. ed. | 275 x 220
mm | 256 p | 180 col.ill. | ISBN:
9781849761468 | € 42,00 [BE] / € 42,00 [NL] /
€ 39,80 [INT]| July 2014
MODERN ART
Asger Jorn
Restless Rebel
A key artist in the European post-war
Avant-Garde, Asger Jorn worked within
several, sometimes-conflicting art movements.
He believed images to be of more fundamental
importance than words, but wrote a host of
books himself. This lavishly illustrated volume
addresses the contradictions in Jorn's oeuvre
as part of a deliberate artistic strategy, and
presents the heterogeneity of his oeuvre as a
significant feature.
Expo: 28/2/2014 - 15/6/2014, Statens
Museum for Kunst, Copenhagen
[UK] Prestel | Hardback | Eng. ed. | 300 x 240
mm | 288 p | 300 col.ill. | ISBN:
9783791353579 | € 48,95 [BE] / € 48,95 [NL]
/ € 48,95 [INT]| Feb. 2014
Emil Nolde
Retrospective
Felix Krämer, with contributions by Max
Hollein, Filx Krämer, Christian Ring and Aya
Soika
Known as a master of colour, Emil Nolde used
many different types of media besides painting,
including watercolor, drawing, and prints, to
create works such as his numerous flower
paintings and coastal landscapes. The book
explores Nolde's expressionist painting
technique and reexamines Nolde's motives as
an artist, by looking at how his works were
received and how this was shaped by the
artist's image of himself.
Expo: 5/3/2014 - 15/6/2014, Städel
Museum, Frankfurt. Travelling to the
Louisiana Museum of Modern Art, Humlebaek
[UK] Prestel | Hardback | Eng. ed. | 280 x 230
mm | 300 p | 355 col.ill. | ISBN: 9783791353357|
€ 69,95 [BE] / € 69,95 [NL] / € 69,95 [INT]
| March 2014
ExpressionQisme
en Allemagne et en Françe
De Van Gogh à Kandinsky
Expressionism
in Germany and France
From Van Gogh to Kandinsky
This groundbreaking examination of the
cultural exchange between early 20th century
French and German artists illuminates new
ways of understanding the development of
Expressionism. Although the Expressionist
movement is widely considered to have arisen
out of a German aesthetic, it was actually as
much a result of German artists exposure to
artists living and working in France, such as
van Gogh, Seurat, Gauguin, Cezanne, Matisse,
Picasso, and Braque.
Cet ouvrage propose une relecture révolutionnaire
des liens et des échanges culturels qui, au début
du vingtième siècle, se sont noués entre les artistes
français et allemands. Il éclaire d'un jour nouveau
notre compréhension du développement de
l'expressionnisme. On considère généralement que
ce mouvement artistique trouve son origine dans
l'Esthétique allemande, bien qu'en réalité il fut aussi
tributaire de la découverte, par les artistes allemands,
des travaux d'artistes actifs en France et qui ont nom
van Gogh, Seurat, Gauguin, Cézanne, Matisse,
Picasso et Braque.
Expo: 07/2/2014 - 11/05/2014, Kunsthaus, Zurich |
8/6/2014-14/9/2014: Los Angeles County Museum
of Art
[UK] Prestel | Hardback | French ed. & Eng. eds.|
310 x 220 mm | 256 p | 200 col.ill. | ISBN:
9783791353418 (Fr) | ISBN 9783791353401 (Eng)
| € 69,95 [BE] / € 69,95 [NL] ( € 69,95 [INT]|
June 2014
Degas / Cassatt
Hammershoi and Europe
Kimberly A. Jones
Edgar Degas's influence upon Mary Cassatt
has long been acknowledged, but her role in
shaping his artistic production and in preparing
the way for his warm reception in America is fully
examined for the first time. These two major
figures of the impressionist movement shared
a keen observer's eye, as well as openness to
experimentation. Despite differences of gender
and nationality, they built a deep friendship
based on mutual respect and admiration for
each other's talents.
Expo: 11/5/2014 - 5/10/2014, National Gallery
of Art, Washington, DC |
[UK] Prestel | Hardback | Eng. ed. 273 x 241 mm |
ISBN: 9783791353647 | 192 p | 140 col.ill. |
€ 48,95 [BE] / € 48,95 [NL] / € 48,95 [INT]|
May 2014
Kasper Monrad
This generously illustrated volume examines
Hammershoi's work as a whole and in relation
to the artists of his generation. Hammershoi's
enigmatic paintings, with their rich and muted
palettes, have always enjoyed enormous
popularity in Scandinavia, and recently his
work has received renewed attention across
the globe.
[UK] Prestel | Paperback | Eng. ed. | 300 x
240 mm | 256 p | 256 col.ill. | ISBN:
9783791353609 | € 34,95 [BE] / € 34,95 [NL]
/ € 34,95 [INT]| April 2014
Now available in a paperback edition
15
CONTEMPORARY ART
Berlinde 'e Bruyckere
Edited by Angela Mengoni. With texts of Angela Mengoni,
Emmanuel Alloa and Gary Carrion-Murayari
"De Belgische kunstenares Berlinde De Bruyckere (geb. 1964) dankt haar
bekendheid in de hedendaagse kunstwereld aan de heel vernieuwende
wijze waarop ze de beeldhouwkunst benadert. Deze publicatie is de
eerste monografie die aan De Bruyckere is gewijd. Ze gunt ons een
definitieve en allesomvattende blik op de verscheidenheid van haar
oeuvre van de voorbije twintig jaar. Het boek omvat de eerste sculpturen
van De Bruyckere uit de jaren 1990, vooral bespiegelingen over de
menselijke figuur gemaakt van was en wol, haar latere sculpturen met
paarden die haar internationale faam verzekerden, evenals de
fascinerende installatie die ze recent maakte voor het Belgische Paviljoen
op de Biennale di Venezia (2013). De werken van De Bruyckere, die hier
in meer dan tweehonderd fraaie illustraties worden belicht, zitten vol
bevreemdende tegenspraken - ze zijn tegelijk uitnodigend en
verwarrend, anatomisch en abstract. Dit boek is een onmisbare
informatiebron over een kunstenares die met haar werken een
provocerende en bepalende impact op de hedendaagse kunstcanon
uitoefent."
"L'artiste belge Berlinde De Bruckyere (née en 1964) est une star de l'art
contemporain, dont la pratique innovante se focalise sur la sculpture. Cet
ouvrage, la toute première monographie à lui être consacrée, propose un
aperçu exhaustif et définitif de son oeuvre sur plus de vingt années. Il
comprend ses premières sculptures des années 1990, méditations sur la
figure humaine à base de cire et de laine, ses corps de chevaux qui lui
ont valu la notoriété internationale, et l'installation envoûtante qu'elle a
réalisée, en 2013, pour le Pavillon belge à la Biennale de Venise. Les
oeuvres de De Bruckyere, présentées en plus de deux cents illustrations,
sont pétries de contradictions - à la fois séduisantes et repoussantes,
anatomiques et abstraites. Cette monographie est un livre-ressource sur
une artiste dont l'oeuvre provocatrice constitue un apport décisif à l'art
contemporain."
L'ouvrage comprend deux essais philosophiques inédits dus au
philosophe et théoricien Emmanuel Alloa et à l'historienne de l'art Angela
Mengoni. Gary Carrion-Murayari a bâti pour sa part une réflexion sensible
sur l'oeuvre graphique de l'artiste.
[BE] Fonds Mercator/ Mercatorfonds | Hardback | NL ed. |
300 x 215 mm | 300 p | 250 col.ill. |
ISBN: 9789462300378 (NL)
ISBN: 9789462300385 (Fr)
ISBN:9789462300392 (Eng)
€ 64,95 [BE] / € 64,95 [NL] (CB)/ € 61,27 [INT]|
May 2014
Expo: 18/10/2014 - 8/2/2015, SMAK, Gent 28/2/2015-28/6/2015, Haags Gemeentemuseum
16
CONTEMPORARY ART
Michaël Borremans
As Sweet as it Gets
Ed.: Jeffrey Grove. Texts: Jeffrey Grove u.a., Design: Kim Beinaert
Sinds hij zich eind jaren negentig volledig op kunst ging toeleggen, heeft
Michaël Borremans (°1963 in Geraardsbergen, België) een opvallend rijp
oeuvre opgebouwd dat internationale aandacht krijgt. De vervreemdende
ruimten die hij in zijn schilderijen, tekeningen, sculpturen en films
oproept zijn gebaseerd op een geheimzinnig gevoel voor ontwrichting en
voor vaak verwarrende schoonheid.
Met een complex palet en verfijnde technieken sluit Borremans' werk
tegelijk aan bij een rijke erfenis van artistieke voorgangers, en is het
sterk verankerd in het heden. Met reproducties van bijna tweehonderd
werken die in een periode van veertien jaar zijn ontstaan, waarvan
meerdere nog nooit eerder in boeken of catalogi werden afgedrukt, is
deze publicatie het meest complete overzicht van Borremans' oeuvre tot
nu toe. Naast een interview met de kunstenaar, bevat het negenenvijftig
uiterst individuele bijdragen van schrijvers, curatoren, cineasten en
muzikanten, die telkens over specifieke werken van Borremans schrijven.
Depuis qu'il se consacre à l'art, c'est-à-dire depuis la fin des années
1990, Michaël Borremans (°1963, Grammont, Belgique) a produit une
oeuvre d'une maturité frappante qui a très vite attiré l'attention
internationale. Les espaces disparates qu'il imagine dans ses tableaux,
ses dessins, ses sculptures et ses films se fondent sur un mystérieux
sens de la dislocation et une beauté souvent troublante. Rendue au
moyen d'une palette complexe et d'une technique virtuose, l'oeuvre de
Borremans conjugue un riche héritage artistique d'éminents
prédécesseurs avec un ancrage profond dans le présent. Près de 200
reproductions d'oeuvres réalisées sur une période de quatorze ans - dont
certaines étaient encore inédites - illustrent cette vaste publication qui
offre le panorama le plus complet à ce jour de l'oeuvre de Michaël
Borremans.
Outre une interview de l'artiste, cet ouvrage rassemble cinquante-neuf
contributions hautement individuelles d'écrivains, de commissaires
d'expositions, de cinéastes et de musiciens qui, chacun à sa manière,
commentent une sélection de tableaux et de dessins.
[G] Hatje Cantz | Hardback | NL ed. | 340 x 290 mm |
304 p | 196 col.ill. |
ISBN: 9783775737708 (N)
ISBN: 9783775737715 (Fr)
ISBN: 9783775737692 (Eng)
| € 49,80 [BE] |€ 49,80 [NL]/ € 49,80 [INT] | Feb. 2014
Expo: 22/2/2014 - 3/8/2014, Bozar, Brussels |
4/9/2014-31/1/201: Tel Aviv Museum of Art
Price after 3/8/2014: € 55,00
17
CONTEMPORARY ART
Jean-Michel Basquiat
Niki De Saint Phalle
(Reprint)
Christiane Weidemann
Rudy Chiappini (editor), Achille Bonito Oliva, ...
Niki de Saint Phalle's biography reads like a bestselling
novel: a difficult education, early fame as a fashion
model, and family rebellion. Her earliest works, known
as shooting paintings, were executed with a rifle and
paint-filled bullets. She went on to explore
women's identities through papiermache figures.
As her reputation grew, so did her works. Her larger
than-life Nanas could be entered and viewed from within.
She created sculpture parks in Israel, Italy, and California,
among other places.
Features Basquiat's work from 1981-the year
of his first official participation in the group
exhibition New York/New Wave at PS1 of New
York-to his premature death in 1988.
Controversial cult artist, enfant terrible of the art
world, friend of Haring and Warhol, youth idol and
tragic victim of a heroin overdose, Jean-Michel
Basquiat was a legend in his own lifetime.
This publication provides an excellent overview.
[UK] Prestel | Paperback | Eng. ed. |
240 x 193 mm | 128 p | 100 col. & bw ill. |
ISBN: 9783791349756 |
€ 13,95 [BE] / € 13,95 [NL] / € 13,95 [INT]|
April 2014
[UK] Skira | Hardback | Eng. ed. |
280 x 250 mm | 200 p | ISBN: 9788876242649 |
€ 51,50 [BE] / € 51,50 [NL] / € 51,50 [INT]|
Feb. 2014
Reprint
Andy Warhol
Keith Haring
The Complete commissioned Posters
1964-1987
Commemorating the 50th anniversary of the
artist's birth, this book is the intended to be a
faithful posthumous execution of the project.
Containing a wealth of unpublished materials, and
representing a decade of work and research,
it promises to be the definitive book
on the artist's life and work. Beginning with his
very first collages and early subway tags
through the development of the iconic graphic work
now synonymous with his name, the bookfollows
his meteoric rise to international stardom.
This richly illustrated book catalogs all of
Warhol's posters commissioned for a specific
purpose and features original artwork.
Arranged chronologically, they present a
fascinating array of subjects, including cultural
events, musicians, political campaigns, and iconic
brands. Each of the posters is exquisitely reproduced,
including some with multiple variations, and
accompanied by informative texts and comparative
illustrations.
[US] Rizzoli | Hardback | Eng. ed. | 254 x 228
mm | 528 p | 600 col. & bw ill. | ISBN:
9780847842988 | € 46,00 [BE] / € 46,00 [NL]
/ € 46,00 [INT]| April 2014
[UK] Prestel | Hardback | Eng. ed. | 330 x 250
mm | 176 p | 175 col.ill. |
ISBN: 9783791349718 |
€ 48,95 [BE] / € 48,95 [NL] / € 48,95 [INT]|
April 2014
18
CONTEMPORARY ART
Elly Strik
Ricardo Brey
Ghosts, Brides & other companions
Que le importa al tigre une raya más
Ben Okri, Manuel Borja-Villel, Bart Verschaffel, Carlos Gamerro,
Jean-Christophe Ammann, Victoria Noorthoorn & Beatriz Preciado
Bart De Baere, John Welchman, Jimmie Durham, Sandra Sosa, Thomas
Mießgang, Jesse McKee
Strik's book is a fluent stream of images and words in a strong
connection to each other where the look inside and the outside happens
simultaneously. The images continue within a long historic artistic line of
visionary artists who probe the tresholds of human essence. Strik's
intense, poetic practice explores the possibilities of metamorphosis and
the process of (artistic) creation. In conversation with aspects from El
Greco, Goya, Darwin, Freud, Munch, Ensor or Duchamp her approach is
archaïc in a higly alert way. The viewer will be confronted with
energetically-charged apparations transmuted into shapes, portraits and
figures on paper, now fixed as definitive states of being. Constantly
shifting between monumentality and intimacy, her figures are a visual
stimulation that prompt the viewer to rethink the human condition today.
The book ties in the exhibition by Elly Strik in Museum Reina Sofia in
Madrid and has over 250 color and 120 black and white images, three
exclusive poems by Ben Okri , three essays by Bart Verschaffel, Beatriz
Preciado, Carlos Gamerro and Victoria Noorthoorn, and a conversation
between Elly Strik and art historian and writer Jean-Christophe Ammann.
This book can be seen as the core - or at least a main synthesis - of the
overall aspiration of Ricardo Brey for his upcoming project in Cuba. It has
therefore been developed as a separate undertaking. While it is not an
artist book in the traditional sense, it is definitively a project by an artist.
Its ambition is to create a sense of the artistic space that Brey wants to
offer, with a polyphony of voices and an immersive sphere in which a
quality of behavior is of prime importance. It will offer an integral view of
his oeuvre, in which the historical is integrated but the focus is on
present validity.
[BE] MER.paperkunsthalle | Paperback | Eng./ Span. ed | 310 x 240
mm | 288 p | ISBN: 9789491775352 | € 35,00 [BE] / € 35,00 [NL]
(CB)/ € 33,02 [INT]| April 2014
Expo: 22/1/2014 - 26/5/2014, Reina Sofia, Madrid
[BE] AsaMER | Hardback | Eng./ Span. ed | 300 x 220 mm | 296 p |
ISBN: 9788480264839 | € 35,00 [BE] / € 35,00 [NL] (CB)/ € 33,02
[INT]| Jan. 2014
19
CONTEMPORARY ART
Ysbrant
Johan Creten
Schilderijen-Paintings, 2002-2014
Gulden Snede
Frank Herreman & Marc Ruyters
Introduction: Oscar van den Boogaard
Ysbrant is een schilder. Schilderen is het
medium dat consequent zijn voorkeur geniet.
Op het eerste zicht lijken zijn doeken een kluwen
van figuren en objecten. Op het tweede zicht ontdekt
men echter een ordening waarin die mensen en
objecten, samen met wolken, lucht en water hun
plaats krijgen om een verhaal te vertellen.
Voor zijn 7e solotentoonstelling in galerie
Transit realiseerde Johan Creten [°1963, Sint-Truiden]
een reeks van dertien unieke wandwerken met als titel
'Gulden Snede'. De werken hebben iets mysterieus en
mystieks in hun ogenschijnlijke eenvoud.
Het zijn gebalde, geconcentreerde, handgevormde
wandsculpturen in geglazuurd steengoed, op de rand
balancerend tussen abstractie en suggestieve figuratie,
tegelijk mannelijk en vrouwelijk. Oscar van den Boogaard
schrijft over de nieuwe reeks.
Expo: 2/2/2014 - 23/3/2014, Galerie
Transit, Mechelen
[BE] Fonds Mercator/ Mercatorfonds |
Hardback | Eng./ NL ed. | 295 x 235 mm |
208 p | ISBN: 9789462300477 | € 39,95 [BE]
/ € 39,95 [NL] / € 37,69 [INT]| May 2014
[BE] Transit Gallery | Hardback | Eng./ Fr./ NL
ed. | 240 x 170 mm | 48 p | throughout col.ill.
| ISBN: 9789081240727 | € 14,95 [BE] / €
14,95 [NL] / € 14,95 [INT]| Feb. 2014
Peter Halley. Since 2000
Todd & Fitch
(incl. DVD)
Nicolas Todd - Damien Fitch
Essai par Jo Melvin
Sylvain Alliot. Design: Speculoos
L'iconographie des oeuvres de Peter Halley se nourrit de
références à l'architecture mais aussià l'organisation sociale.
Cette peinture est liée à notre expérience du quotidien :
les codes géométriques - qu'on pense par exemple à la
signalétique urbaine - ont envahi nos modes d'accès au
monde jusqu'à s'y substituer ; le langage abstrait est utilisé
comme un outil de représentation du réel.
DVD en anglais uniquement contenant un
présentation de et par l'artiste.
Expo: 18/1/2014 - 18/5/2014 . DVD in
English language., Musée d'art moderne
Saint-Etienne Métropole
Todd & Fitch, duo d'artistes français, est la réunion
des artistes contemporains Nicolas Todd (1969) et
Damien Fitch (1964), qui travaillent ensemble depuis
le début des années 2000. Leur univers initialement
abstrait, évolue peu à peu vers un champ plus
narratif et s'empare des figures et des symboles du
XXe siècle. Leurs oeuvres sont le fruit d'un travail
extrêmement rigoureux, où la recherche de perfection
et d'équilibre est une constante.
Expo: 24/10/2013 - 7/12/2013, Galerie
Agnès Monplaisir, Paris
[BE] Vision | Hardback | Eng./ Fr. ed. | 285 x
240 mm | 164 p | throughout col.ill. | ISBN:
9789079881253 | € 50,00 [BE] / € 50,00 [NL]
/ € 47,17 [INT]| Dec. 2013
[BE] Occ. Publishers Belgium | Hardback |
French ed. | 308 x 308 mm | 88 p | ISBN:
9782930487137 | € 40,00 [BE] / € 40,00 [NL]
/ € 37,74 [INT]| Jan. 2014
20
CONTEMPORARY ART
Crossing China
Anne-Mie Van Kerckhoven
Heidi Voet
Het oneindige en de tijdelijkheid
One in Many
Design: Studio Luc Derycke
Heidi Voet's multi-disciplinary artistic practice
is characterized by her playful and
transformative use of objects to make critical
social commentaries about everyday life. She
transforms the banal into something wondrous.
For one of her best-known series, Voet created
elaborately patterned rugs by weaving
thousands of colorful digital watches. The
watches all have synchronized alarms, but
inevitably malfunction and chime off beat over
time creating an impromptu electronic sound
installation.
Seven selected poems by Antwerp-based artist
Anne-Mie Van Kerckhoven (°1951), illustrated
with some of the artist's original black and
white pen drawings.
[BE] MER.paperkunsthalle | Paperback | NL
ed. | 260 x 200 mm | 16 p | ISBN:
9789491775437 | € 20,00 [BE] / € 20,00 [NL]
/ € 18,87 [INT]| April 2014
Land of the Rising Art Scene
[BE] MER.paperkunsthalle | Hardback | Eng.
ed. | 280 x 200 mm | 140 p | throughout
col.ill. | ISBN: 9789491775253 | € 33,00 [BE]
/ € 33,00 [NL] / € 31,13 [INT]| Jan. 2014
Ghosts are Guests
Jean-Pierre Ransonnet
Myriam Hornard. Collection « Livres d'art
»
Une Biographie <Côté arts>
Textes de Myriam Hornard, Jean-Philippe Uzel,
François Liénard et Sabrina Parent
Le travail de Myriam Hornard peut être défini
comme une tentative artistique pour
représenter, évoquer voire affecter le temps.
L'impermanence des choses et des êtres les
conduit à connaître des transformations de leur
matière qui s'imprègnent dans notre mémoire
où ils s'invitent à la manière de fantômes.
Expo: 21/9/2013 - 26/10/2013, Centre
d'art de la Ville de Dudelange Nei Liicht
[BE] Lettre Volée (art et photographie) |
Hardback | Eng./ Fr. ed. | 240 x 170 mm | 112
p | 25 col.ill. | ISBN: 9782873174170 | €
29,00 [BE] / € 29,00 [NL] / € 27,36 [INT]|
Sept. 2013
Textes inédits de Julie Bawin et Roger Pierre
Turine.
dessins /// peintures /// photographies ///
sculpture /// collages /// textes...
la pierre /// les ciels /// les jeux /// les sapins
/// la forge /// les forêts /// les
visages-paysages /// le bleu /// les sapins
rouges /// les paysages avec pont /// les
personnages /// l'aide-mémoire /// le voyage
/// le théâtre /// les paysages /// ça peint ///
les outils /// les jardins /// les dessins,
collages, gouaches et peintures satiricoérotiques /// les paysages d'Ardenne
/// l'étang /// l'école /// ...
[BE] Yellow Now | Paperback | French ed. |
240 x 170 mm | 416 p | throughout col.ill. |
ISBN: 9782873403478 | € 40,00 [BE] / €
40,00 [NL] / € 37,74 [INT]| Jan. 2014
21
Edited by Gérard Goodrow
CROSSING CHINA introduces the highly
fascinating art scene in China at the dawn of
the 21st century. The book is conceived as a
journey through the seven major cultural
capitals of the rapidly changing People's
Republic of China: Beijing, Shanghai, Hong
Kong, Shenzhen, Hangzhou, Chengdu and
Guangzhou. Each chapter introduces the major
stakeholders in the interrelated fields of art,
architecture and photography.
[G] Daab Media | Hardback | Eng./ Germ. ed.
| 280 x 240 mm | 400 p | throughout col.ill. |
ISBN: 9783942597128 | € 125,00 [BE] / €
125,00 [NL] / € 125,00 [INT]| Jan. 2014
Previously announced
CONTEMPORARY ART
Gerhard Richter
A Brush with the Real
Figurative Painting Today
Georges Didi-Huberman, Dietmar Elger, Michiko Kono, Hans Ulrich
Obrist, Dieter Schwarz, graphic design by Uwe Koch
The companion volume to the large-scale exhibition at the Fondation
Beyeler, featuring works on loan from collections in Europe and overseas
.
A Brush with the Real: Figurative Painting Today presents a dynamic new
approach to figurative painting. By examining the work of a carefully
curated collection of 51 contemporary artists, this book celebrates the
unprecedented revival of figurative painting in its many new forms.
Arranged in three thematic parts, this book reveals the background,
tools, reference materials and media that inspire each artist to take
figurative painting in new directions. We peer into painters' lives to
witness the use of groundbreaking digital technologies, the building of
large-scale sets and painstaking methods of preparing materials, all
resulting in hugely complex and inspiring works.
Over the sixty years of his artistic career, Gerhard Richter (* 1932 in
Dresden) has produced a standardsetting oeuvre whose thematic and
stylistic diversity has no equal among the art of our time. This extensive
monograph is the first to present the complete range of the numerous
works Richter realized as series, cycles, and spaces. It includes figurative
paintings, such as landscapes, still lifes, and portraits, many of which are
based on photographs, such as the series S. and Child, a personal and
intimate variation on the traditional subject of the Madonna and Child. It
also features abstract works, for which Richter draws from a changing
repertoire of forms and colors to produce both small and monumental
paintings. This generously sized volume reveals an astonishing spectrum
of Richter's paintings in all of their dimensions and techniques.
[UK] Laurence King | Paperback | Eng. ed. | 280 x 216 mm | 320 p |
ISBN: 9781780672830 |
€ 36,00 [BE] / € 36,00 [NL] (CB)/ € 36,00 [INT]|
March 2014
Expo: 18/5/2014 - 7/9/2014, Fondation Beyeler, Riehen/ Basel
[G] Hatje Cantz | Hardback | Eng. ed. | 315 x 280 mm | 256 p | 180
col. & bw ill. | ISBN: 9783775738057 | € 49,80 [BE] / € 49,80 [NL]
(CB)/ € 49,80 [INT]| May 2014
22
CONTEMPORARY ART
Jan Fabre: Stigmata
Damien Hirst
Actions & Performances 1976-2013
Relics
Germano Celant
Visual artist, choreographer, writer and director, Jan Fabre has been one
of the most influential figures on the European scene for over twenty
years. His provocative forays into all different art forms are aimed at
breaking down the artistic and moral barriers of his times. Published on
the occasion of the exhibition of Fabres works at the MAXXI in Rome, the
monograph brings together, for the first time, the action art and
performances of the Belgian artist from the 70s to the present: drawings,
thinking models, collages, films, photos and other documentation that lay
the groundwork for a rediscovery of dozens of Fabres performances and
interventions, both public and private, held in Belgium and abroad. The
extreme, even brazen exploration of the human body, which frequently
scandalizes viewers, is linked to the idea of metamorphosis, which Fabre
may have derived from that passion for the sciences he inherited from
his great-grandfather, the esteemed entomologist Jean-Henri Fabre. Jan
Fabre has devoted much of his career to studying the human body and
its transfiguration, central themes in his work; the artist considers
performance art a per-for-a(c)tion of the body with respect to the outer
world: a way to explore its limits, actions and reactions, both inside and
out.
Published on the occasion of Relics, Hirsts first retrospective exhibition in
Doha, Qatar, this richly illustrated book offers a different perspective on
the work of one of the best-known artists working today. Tracing Hirsts
career from his emergence on the art scene in the Young British Artists
movement to his present status as one of the most controversial and
highly regarded artists of his generation, the volume offers a complete
overview on his wideranging practice, which includes installation,
painting, sculpture and drawing, and challenges the boundaries between
art, science and popular culture. The catalog gathers over one hundred
works, combining historic oeuvres with more recent projects: from The
Kingdom to The history of pain, from Pharmacy to For the Love of God,
to the spot, spin and butterfly paintings. With an essay by Francesco
Bonami, and an interview to the artist by Nicholas Serota, Director of
Tate, the volume offers an original point of view on Hirsts oeuvre, thanks
to the essays by the Qatari writer Sophia Al Maria and the Pakistani
writer Mohsin Hamid. A unique contribution to our understanding and
appreciation of Damien Hirst, whose works have become collective icons
of our civilization.
Expo: 10/10/2013 - 22/1/2014, Doha, Qatar
Expo: 16/10/2013 - 23/2/2014, MAXXI, Rome
[UK] Skira | Hardback | Eng. ed. | 310 x 260 mm | 296 p |
ISBN: 9788857220741 |
€ 68,50 [BE] / € 68,50 [NL] (CB)/ € 68,50 [INT]|
Nov. 2013
[UK] Skira | Hardback | Eng. ed. |297 x 210 mm | 512 p | 650 col.
& bw ill. | ISBN: 9788857221243 |
€ 94,00 [BE] / € 94,00 [NL] (CB)/ € 94,00
[INT]| April 2014
23
CONTEMPORARY ART
Lynette Yiadom-Boakye
Raoul De Keyser
The Last Wall
Jef Van Eynde, Piet De Keyser
Based in London, Lynette Yiadom-Boakye has emerged in recent years as
a major talent in the international art scene, winning widespread acclaim
for her large-scale, luminous portraits. Working in a luxuriously dark,
muted palette offset by bursts of radiant colour, Yiadom-Boakye paints
subjects from her imagination, whose stories she sometimes elaborates
through short fiction. Whether with a shy smile, leering, or evading one's
gaze, Yiadom Boakye's subjects consistently confront the viewer with a
beguiling sense of intimacy and the implication of larger, hidden life. This
volume surveys the artist's remarkable career to date through beautiful,
full-page illustrations. Also featured are two critical essays that assess
the artist's practice and distinctive approach to portraiture, an interview
with the artist, as well as short stories by the artist that give life to her
paintings.
The Last Wall is centred around the last exhibition project that painter
Raoul De Keyser conceived on his studio wall. Due to the painter's
untimely death in October 2012, the project never made it to the
exhibition venue; Jef Van Eynde's pictures being the sole testimony, a
tribute to this wonderful artist. This small volume, the sole exhibition.
[BE] MER.paperkunsthalle | Hardback | Eng. ed. | 230 x 170 mm | 40 p
| ISBN: 9789491775284 | € 25,00 [BE] / € 25,00 [NL] (CB)/ € 23,58
[INT]| March 2014
Previously announced
[UK] Prestel | Hardback | Eng. ed. | 270 x 210 mm | 128 p | 85 col.ill. |
ISBN: 9783791349671 | € 41,50 [BE] / € 41,50 [NL] (CB)/ € 41,50
[INT]| April 2014
24
HISTORY
The First World War in
Photographs
De oorlog vanuit de lucht
Professor Richard Holmes
1914-1918 Het front in België
Birger Stichelbaut, Piet Chielens
100 jaar geleden barst in Europa de Eerste
Wereldoorlog los. Luchtfotografie, toen een nog
vrij nieuwe technologie, werd al snel een
onmisbaar instrument. Dit uitzonderlijk boek
brengt honderddertig cases samen. De auteurs
tonen aan de hand van luchtfoto's, kaarten en
historische documenten, met een nooit geziene
precisie de omvang van de Eerste Wereldoorlog
en de dramatische impact op het landschap.
Verhelderende transparanten laten toe de
luchtfoto's echt 'te lezen'.
[BE] Fonds Mercator/ Mercatorfonds |
Hardback | Dutch (NL), French and Eng. eds. |
245 x 295 mm | 352 p | 500 col.ill. |
ISBN: 9789462300248 (NL)
ISBN: 9789462300255 (Fr)
ISBN: 9789462300262 (Eng) |
€ 69,95 [BE] / € 69,95 [NL] / € 65,99 [INT]|
La guerre vue du ciel
1914-1918 Le front en Belgique
Birger Stichelbaut, Piet Chielens
Une remarquable évocation photographique de
la Première Guerre Mondiale, avec sa
progression implacable et son pouvoir de
destruction, vue du ciel au-dessus du champ de
bataille flamand.
7KH*UHDW:DU6HHQ)URPWKH$LU
,Q)ODQGHUV)LHOGV
The First World War in Photographs captures
the patriotism and innocence of the men and
women who volunteered for their countries, the
reality of trench warfare on the Western Front,
the sea battles in oceans around the globe, the
terror of gas and mechanized weaponry, and
the ultimate sacrifice of a generation. Published
in association with the Imperial War Museums
to coincide with the 100th Anniversary of the
start of the First World War.
Imperial War Museums / Andre Deutsch
[UK] Carlton | Hardback | Eng. ed. | 280 x
230 mm | 320 p | 400 bw ill. | ISBN:
9780233004198 | € 36,00 [BE] / € 36,00
[NL] / € 36,00 [INT]| June 2014
Avec 40 calques transparents
Met 40 transparanten
Dec. 2013
Mapping It Out
An Alternative Atlas of Contemporary
Cartographies
Edited by Hans Ulrich Obrist. Introduction by
Tom McCarthy
Over 130 leading lights from different fields
artists, architects, writers and designers,
geographers, mathematicians, computer
pioneers, scientists make sense of exterior and
interior worlds through highly personal and
imaginative maps and charts. Some have
translated scientific data into simplified visual
language, while others have condensed vast
social, political or natural forms into concise
diagrams.
[UK] T & H | Hardback | Eng. ed. | 198 x 270
mm | 240 p | ISBN: 9780500239186 | € 36,00
[BE] / € 36,00 [NL] / € 36,00 [INT]| May 2014
Mandela: A Film and Historical
Companion
A History Of The First World War
In 100 Objects
This official companion book to the major
feature film Mandela: The Long Walk Home
retraces the life of Nelson Mandela in a wholly
original way, weaving together his own words
and historic humanitarian efforts with
cinematic narrative and exclusive
behind-the-scenes content. It's a movie tie-in
unlike any other: a lavishly illustrated mesh of
fiction and history, featuring film stills
alongside archival photographs of actual
events; commentary from the acclaimed cast
and filmmakers plus interviews...
A History of the First World War in 100 Objects
narrates the causes, progress and outcome of
the First World War by telling the stories
behind 100 items of material evidence of that
cataclysmic and shattering conflict. Each object
is depicted on a full page and is the subject of
a short chapter that 'fans out' from the item
itself to describe the context, the people and
the events associated with it.
In Association With The Imperial War
Museum
[US] Chronicle Books | Hardback | Eng. ed. |
254 x 241 mm | 160 p | 250 col.ill. | ISBN:
9781452128412 | € 31,50 [BE] / € 31,50 [NL]
/ € 31,50 [INT]| Nov. 2013
25
[UK] Cassell | Hardback | Eng. ed. | 246 x 189
mm | 448 p | 200 col.ill. | ISBN:
9781844037445 | € 36,95 [BE] / € 36,95 [NL]
/ € 36,95 [INT]| March 2014
PHOTOGRAPHY
Impressions of a Lost World
Jimmy Nelson
A Century of Chinese Photography 1860-1950
Before they pass away
This historic volume showcases tribal cultures around the world. With
globalization, these societies are to be prized for their distinctive
lifestyles, art and traditions. They live in close harmony with nature, now
a rarity in our modern era. Jimmy Nelson not only presents us with
stunning images of customs and artifacts, but also offers insightful
portraits of people who are the guardians of a culture that they-and
we-hope will be passed on to future generations in all its glory. Nelson's
large-plate fi eld camera captures every intricate detail and fine nuance
for posterity. What's more, this splendid pageantry is set against a vivid
ackdrop of some of the world's most pristine landscapes.
Impressions d'un monde disparu
La Chine à travers d'anciennes photographies
Ferdinand M. Bertholet & Lambert van der Aalsvoort. With an
introduction by Régine Thiriez
The flourishing of photography as a medium in the mid-19th century
coincided with a rise in curiosity about China on the part of the Western
world. As the number of foreigners living and traveling in China
increased, early photographs of China were taken by and for an
international audience. Impressions of a Lost World assembles 250
fascinating images of China in the second half of the 19th century and
first half of the 20th, captured by the Western camera lens. The
photographs portray the gritty side of the country as well as stunning
views of palaces, temples, harbors, and gardens. This juxtaposition of
the sordid and the serene provides a multidimensional picture of China's
physical and social landscape before Mao Zedong's ascent to power
changed the country forever. The photographs, many published here for
the first time, are both beautiful and moving, and together offer a new
understanding of a social and cultural history associated with a time of
significant historical change.
Les dernières Ethnies
Avant qu'elles ne disparaissent
Cet ouvrage, qui fera date, présente les cultures tribales de par le monde.
Avec la mondialisation, une attention toute particulière doit être portée sur
ces sociétés pour leurs styles de vie distinctifs, leur art et leurs traditions.
Elles vivent en harmonie totale avec la nature, ce qui est devenue une rareté
dans notre ère moderne. Jimmy Nelson ne se contente pas de nous présenter
à l'aide d'images stupéfiantes les coutumes et les artefacts, il nous offre
également des portraits saisissants de peuples qui sont les gardiens d'une
culture qu'ils ont l'espoir, ainsi que nous, de transmettre dans toute sa
gloire aux générations futures. L'appareil photo de Nelson capture,
pour la postérité, le moindre détail dans sa complexité et dans toute sa
nuance. Qui plus est, cet apparat splendide est mis en valeur sur un fond
de somptueux paysages parmi les plus vierges.
[BE] Fonds Mercator/ Mercatorfonds | Hardback | Eng. ed. |
300 x 250 mm | 224 p | 135 col.ill. |
ISBN: 9789462300224 (Eng) | 9789462300231 (Fr) |
€ 49,95 [BE] / € 49,95 [NL] (CB)/ € 47,12 [INT]|
April 2014
[G] teNeues | Hardback | Eng./ Fr./ Germ. ed. | 370 x 290 mm | 424 p
| 402 col.ill. | ISBN: 9783832797591 |
€ 128,00 [BE] / € 128,00 [NL] / € 128,00 [INT]| Nov. 2013 -R/P
Reprint.
26
PHOTOGRAPHY
Ethiopia
Footsteps in dust and gold
Arjan van Dijk, Jos van Beurden. Photography:
Arjan van Dijk
Ethiopia is an amazing and mysterious country.
People are moved by its rich nature, culture
and history, which are linked both with the
Western and Islamic worlds. Ethiopia is the
home of coffee and khat, the place where the
oldest human being in the world was found. It
harbors the source of the Blue Nile in the west
Sammy Baloji Mémoire / Kolwezi
and numerous treasures of the Ethiopian
Orthodox Church. Rock hewn churches and
their relics lie hidden in the majestic
mountainous landscapes of the north.
Julius Mwelu
Africalia
& The Mwelu Foundation, Nairobi
Sammy Baloji
In de totale miserie van een arme,
overbevolkte stad die maar weinig hoop biedt,
hebben de fotograaf en zijn team
rondgewandeld tussen de mensen, de
plaatstalen daken en de plasticbussen, daar
heeft Julius vooral kinderen en adolescenten
gemotiveerd en gestimuleerd om de wereld
rondom hen anders te bekijken. Nadat hun
mentor hen had geleerd om de lens goed te
gebruiken, hebben de jongeren de toestand in
hun sloppenwijk met een begripvolle, maar
ontegenzeglijk ook kritische blik bekeken.
Africalia Editions
In het zuiden van Katanga, één van de rijkste
gebieden van Afrika, tevens het economisch
hart van Congo, ontstonden er steden rond de
koper- en kobaltmijnen. De verhouding tussen
de mijnindustrie en de bevolking is hier bijna te
vergelijken met de relatie tussen ouders en
hun kinderen. Sinds een tiental jaar maakt
Sammy Baloji foto's van de herinneringen, de
hoop en de voorstellingswereld van die
kinderen van de mijn.
[BE] Stichting Kunstboek | Hardback | Eng./
Fr./ NL ed. | 245 x 235 mm | 168 p | 80 col. &
bw ill. | ISBN: 9789058563965 | € 35,00 [BE]
/ € 35,00 [NL] / € 35,00 [INT]| Feb. 2014
[BE] Stichting Kunstboek | Hardback | Eng./
Fr./ NL ed. | 245 x 235 mm | 144 p | 100 col.
& bw ill. | ISBN: 9789058564030 | € 29,90
[BE] / € 29,90 [NL] / € 29,90 [INT]| Feb. 2014
27
[BE] Stichting Kunstboek | Hardback | Eng.
ed. | 240 x 280 mm | 336 p | 300 col.ill. |
ISBN: 9789058564795 | € 49,90 [BE] / €
49,90 [NL] / € 49,90 [INT]| Feb. 2014
Calvin Dondo Hodhii Zimbabwe
Africalia
Het belangrijkste talent waarover Calvin
volgens de internationale scène beschikt, is dat
zijn werken getuigen van het grote respect dat
hij heeft voor de eigen identiteit van iedereen
die hij op foto vastlegt. Als kunstenaar die ons
het hedendaagse Zimbabwe laat zien, vertelt
hij openlijk over zijn land en over de
geschiedenis die erachter schuilgaat. Dit boek
toont een nieuwe wereld waarvan het beeld
een essentieel bestanddeel vormt.
[BE] Stichting Kunstboek | Hardback | E/ F/
NL/ G ed. | 245 x 235 mm | 120 p | ISBN:
9789058564214 | € 29,90 [BE] / € 29,90 [NL]
/ € 29,90 [INT]| Feb. 2014
PHOTOGRAPHY & ETHNOGRAPHY
Patriarchal Africa
Facing Africa
The Last Sunrise. Photo-chronicle of the
Vanishing Life (incl. DVD)
Kenny John
Facing Africa is an intimate visual document of
Sub-Saharan Africa's most untouched
indigenous cultures. British photographer John
Kenny has spent seven years visiting
thousands of traditional communities: this
book distills the journey into 45 powerful and
illuminating portraits that represent his tireless
curiosity for Africa, its people and for the
human condition.
As a result of five years of work, the
photographs collected in this volume were
taken in different countries: Kenya, Tanzania,
Cameroon, Ethiopia, Djibouti, Botswana,
Morocco, Benin, South Soudan, Mali, Burkina
Faso, Namibia, Zambia, Uganda. The camera
lens of Yastrezhembsky is focused on the
scenes of patriarchal daily routine of Africans,
who try to preserve their adherence to the
traditions of their forefathers in everyday life,
customs, and religion regardless of the rising
pressure of globalization.
[IT] 5 Continents | Hardback | Eng./ Fr. ed. |
324 x 206 mm | 112 p | 45 duotone ill. | ISBN:
9788874396368 | € 41,50 [BE] / € 41,50 [NL]
/ € 41,50 [INT]| Feb. 2014
[UK] Skira | 2 Vol./Boxed | Eng. ed. | 312 x
210 mm | 736 p | 700 col.ill. | ISBN:
9788857219677 | € 160,00 [BE] / € 160,00
[NL] / € 160,00 [INT]| June 2014
Les Iapodes, peuple méconnu
La dynamique des masques en
Afrique occidentale
Dynamics of masks in West Africa
Collections du musée de Zagreb.
Qui sont les Iapodes, ce peuple antique du
Ier millénaire avant J.-C. vivant dans les
régions montagneuses de la Croatie actuelle ?
La civilisation iapode était caractérisée par un
habitat au sein de villes fortifiées édifiées sur
des sites situés en hauteur, par une économie
fondée sur l'agriculture et l'élevage, et par la
présence de nécropoles à inhumation. Au total,
ce sont près de 200 objets sompteux en verre,
en ambre, en bronze (monnaies, parures,
outils, .)
Expo : 14/03/14-14/9/14, Montpellier,
Musée Henri Prades,
Studies in Social Sciences and Humanities,
no. 175
Directed by Anne-Marie Bouttiaux
De dynamiek van maskers wordt duidelijk wanneer ze
tot leven komen en actief zijn in hun natuurlijk milieu,
in tegenstelling tot het dodelijk statische keurslijf dat
hen door de museumomgeving wordt opgedrongen.
Gedragen door een menselijk wezen, dat hen energie
inblaast, worden deze maskers omgetoverd tot enorme
krachten, waarvan de gemeenschap die ze 'ten tonele
voert' veel weldaden verwacht en wiens toorn ze vrezen.
[IT] Silvana | Paperback | French ed. | 280 x
220 mm | 300 p | 250 col.ill. | ISBN:
9788836628063 | € 29,00 [BE] / € 30,80 [NL]
/ € 29,00 [INT]| March 2014
[BE] Africamuseum Tervuren (KMMA) |
Paperback | Eng./ Fr. ed. | 297 x 210 mm |
224 p | throughout col.ill. | ISBN:
9789491615092 | € 45,00 [BE] / € 51,00 [NL]
/ € 48,00 [INT]| Dec. 2013
28
PHOTOGRAPHY
Bruxelles
Marie-Françoise Plissart
Photography: Marie-Françoise Plissart.
Texts: VIncent Cartuyvels
Marie-Françoise Plissart zet vandaag haar
onderzoek naar de stad verder vanop de
torens. Hier komt het radicale karakter van
haar aanpak tot uiting in het panoramisch
beeldformaat, dat alles wil omvatten en de
energie van de stromen tot uiting wil doen
komen van de ene tot de andere rand van het
beeldoppervlak. Bij een haast picturale
behandeling van het stadsbeeld, vinden de
beelden hun kracht in de botsing tussen
volumes en banen, in de spanningen tussen
kanteling en tegengewicht.
[BE] Prisme | Hardback | Eng./ Fr./ NL ed. |
300 x 280 mm | 60 p | throughout col.ill. |
ISBN: 9782930451121 | € 39,50 [BE] / €
39,50 [NL] / € 39,50 [INT]| Dec. 2013
Bruxelles, Horizon Vertical Brussel, Verticale Horizonten
Avec/ Met film de M.-F. Plissart:
L'occupation des sols
Foto's: Marie-Françoise Plissart. Teksten:
Benoit Peeters
Brussel, de hoofdstad van Europa zoals u ze
nog nooit zag!
Originele foto's van een stad vol verrassingen
die haar oude allure heeft behouden en er als
van nature de hedendaagse architectuur in
integreert.
Bruxelles, capitale de l'Europe comme vous ne
Oasis
Architecture traditionnelle de terre /
Raw-earth Architecture
Marie Schuiten, Marcelle Rabinowicz
Entre photographie d'architecture et reportage
sociologique, le travail de MARIE SCHUITEN
nous révèle l'esprit de l'architecture
vernaculaire. Elle ne cherche pas à reproduire
l'évidence mais bien à nous transmettre
l'essence même de cette architecture qui a
touché de nombreux architectes à travers le
monde. La photographe pose lentement son
regard sur cette architecture de terre née au
milieu du désert égyptien. Elle nous invite à
partager sa passion pour ces villages
abandonnés, à regarder ces formes do
Expo: 29/01-13/04/2014, CIVA
[BE] Arp2 Art & Research Publ. | Hardback |
Eng./ Fr. ed. | 240 x 210 mm | 96 p | 144 col.
& bw ill. | ISBN: 9782930115276 | € 32,00
[BE] / € 34,00 [NL] / € 32,00 [INT]| Jan. 2014
Gilbert Fastenaekens:
Correspondance -ReprintBruxelles d'un siècle à l'autre/Brussel van
de ene eeuw naar de andere
Gilbert Fastenaekens
Herfotografie houdt in dat een nieuwe opname
gemaakt wordt die correspondeert met een
oudere foto, waarbij het originele gezichtspunt,
de camera-instelling en andere parameters
zoals het seizoen, het licht, de
brandpuntsafstand . zo veel mogelijk
gerespecteerd worden. Dit protocol, typisch
voor de fotografie en toepasbaar op alle
omgevingen, is een manier om bewuster te
kijken naar 'vertrouwde' locaties - in dit geval
de Brusselse landschappen.
[BE] Arp2 Art & Research Publ. | Paperback |
NL/ Fr ed. | 280 x 300 mm | 168 p | 144 col.
& bw ill. | ISBN: 9782930115153 | € 45,00
[BE] / € 47,50 [NL] / € 45,00 [INT]| Dec. 2013
Retirage - Herdruk
29
l'avez jamais vu! Des photos exceptionnelles
d'une ville pleine de surprises qui a gardé ses
allures d'hier et qui intègre l'architecture
contemporaine tout a fait naturellement.
[BE] Prisme | Hardback | Eng./ Fr./ NL ed. |
300 x 280 mm | 108 p | throughout col.ill. |
ISBN: 9782930451138 | € 49,50 [BE] / €
49,50 [NL] / € 49,50 [INT]| Dec. 2013
Limited edition / Incl. DVD
PHOTOGRAPHY
David Helbich
Belgian Solutions
Belgian solutions is an ongoing, open collection
of photos, which is mainly, but not only,
presented on Facebook. It was started in 2009
by David Helbich, who's photos and title
provide the core of the project. Since he
opened it to the 'public', people responded
massivly with own images. The collection is a
random and endless publication, defined again
and again by it's current constellation; its
ubiquitous title, leading to ever new
significations.
[BE] MediuMER | Paperback | Eng. ed. | 130 x
170 mm | 302 p | throughout col.ill. | ISBN:
9789491775130 | € 20,00 [BE] / € 20,00 [NL]
/ € 18,87 [INT]| Dec. 2013 -R/P
Reprint. First published Oct. 2013
Juliao Sarmento
171 Entertainment Celebs
This extraordinary glittering book by
Portuguese artist Julião Sarmento brings
together one hundred seventy one
entertainment celebrities featuring mainly in
contemporary cinema.
[BE] MER.paperkunsthalle | | Eng. ed. | 105
x 138 mm | 168 p | ISBN: 9789491775338 | €
25,00 [BE] / € 25,00 [NL] / € 23,58 [INT]|
Nov. 2013
Émilia Stefani-Law,
White Days / Le Refuge
Collection : Côté photo / Angles vifs
Émilia Stefani-Law est née à Paris en 1979.
Diplômée en photographie de l'École supérieure
des arts visuels « Le 75 » (Bruxelles).
Le Refuge (c'est ici, dans la tête) et White Days
(l'Amérique, c'est là-bas), deux des séries les
plus récentes d'Émilia Stefani- Law, témoignent
du bel équilibre atteint par la photographe
entre aplomb et fragilité. » (Em. d'A.)
Expo : 06/12/2013-22/12/2013, Galerie
La part du feu, Brussels
[BE] Yellow Now | Paperback | French ed. ,
235 x 165 mm | 160 p | 90 col.ill. | 170 col. &
bw ill | ISBN: 9782873403430 | € 23,00 [BE] /
€ 23,00 [NL] / € 21,70 [INT]| Dec. 2013
30
Philippe Herbet.
Lettres du Caucase. Collection : Côté
photo
Le désir de vagabonder dans les montagnes du
Caucase était en moi depuis des années.
C'étaient les décors tragiques de romans et de
poèmes de Pouchkine, de Lermontov et de
Tolstoï, tout un imaginaire. Le Caucase est une
zone de tension entre l'univers complexe de la
Fédération de Russie et l'Occident, d'enjeux
géostratégiques liés aux hydrocarbures et à
une tentative d'islamisation radicale de la
mosaïque des petites républiques du Nord.
Expo: 5/11/2013-31/12/2013, Galerie
Contretype, Bruxelles
[BE] Yellow Now | Paperback | French ed. |
210 x 170 mm | 144 p | 90 col.ill. | ISBN:
9782873403423 | € 23,00 [BE] / € 23,00 [NL]
/ € 21,70 [INT]| Nov 2013
PHOTOGRAPHY
American Cool
Capa in Color
Dennis Hopper
Joel Dinerstein, Frank H. Goodyear III
Cynthia Young. With a contribution by Sally
Stein
The Lost Album-vintage Prints from the
Sixties
Famed photojournalist and founder of Magnum
Photos, Robert Capa was primarily known for
his black-and-white images. But after World
War II he turned increasingly to colour,
fulfilling assignments for a variety of popular
magazines such as Life and Holiday. This
volume reproduces Capa's colour images in a
wide variety of forms including prints,
magazine spreads, book jackets, and other
ephemera.
Expo: 24/1/2014 - 4/5/2014,
International Center of Photography, New
York
Lying hidden away in Dennis Hopper's home
until their discovery months after the artist's
death in 2010, this collection of spectacular
photographs, exhibited only once in 1969 - 70
at the Fort Worth Art Center Museum, is a
testament to Hopper's prolific and enormous
talent behind the camera. These photographs
are spontaneous, intimate, poetic, observant,
and decidedly political.
Expo: 26/6/2014 - 25/8/2014, Royal
Academy, London
The idea of cool is not only older than we think
- it's also constantly changing, aided by the
mediums of portraiture and film. Readers will
find unexpected and familiar faces here: Walt
Whitman, Frederick Douglass, and Georgia
O'Keeffe, as well as James Dean, Bob Dylan,
and Chrissie Hynde. An extensive selection of
one hundred chronologically arranged portraits,
with biographical information about each
subject, profiles major eras and movements of
the past decades, each with its own brand of
coolness.
Expo: 4/2/2014 - 7/9/2014, National
Portrait Gallery, Washington, DC
[UK] Prestel | Hardback | Eng. ed. | 300 x
250 mm | 244 p | 583 col. & bw ill. | ISBN:
9783791353487 | € 48,50 [BE] / € 48,50 [NL]
/ € 48,50 [INT]| June 2014
[UK] Prestel | Hardback | Eng. ed. | 305 x
230 mm | 196 p | 135 col. & bw ill. | ISBN:
9783791353494 | € 48,95 [BE] / € 48,95 [NL]
/ € 48,95 [INT]| Feb. 2014
[UK] Prestel | Hardback | Eng. ed. | 305 x 255
mm | 208 p | 225 col.ill. | ISBN:
9783791353500 | € 56,00 [BE] / € 56,00 [NL]
/ € 56,00 [INT]| Jan. 2014
David Lynch
Viviane Sassen
Taking Shots
Tbe Factory Photographs
Pikin Slee
The Photography of William S. Burroughs
Petra Giloy-Hirtz
The exterior and interior, black and white shots
of factories in Berlin, Poland, New York,
England, and other locations are filled with
Lynchian characteristics: labyrinthine passages,
decaying walls, industrial waste, and detritus.
Devoid of nature, the dying, manmade structures
are actually being overtaken by nature's innate p
ower. They are haunting cathedrals of a bygone
industrial era - the perfect setting for a David
Lynch film, and a revealing addition to his unique
and fascinating oeuvre.
Expo: 17/1/2014 - 6/4/2014, The
Photographers' Gallery, London
[UK] Prestel | Hardback | Eng. ed. | 300 x 260
mm | 220 p | 160 col.ill. | ISBN:
9783791353333 | € 56,00 [BE] / € 56,00 [NL]
/ € 56,00 [INT]| Jan. 2014
Known for her unique approach to fashion
photography, Viviane Sassen has taken yet
another stylistic detour in her latest collection,
which focuses on the inhabitants of a remote
village on the Upper Suriname River. Sassen's
lens captures the natural beauty of the very
traditional way of living, where mundane
objects can appear extraordinary against the
background of nature's overwhelming
presence.
[UK] Prestel | Hardback | Eng. ed. | 280 x
240 mm | 120 p | 60 col.ill. | 50 bw ill. | ISBN:
9783791349534 | € 41,50 [BE] / € 41,50 [NL]
/ € 41,50 [INT] | March 2014
31
This book, reproducing many previously
unseen images, offers fascinating insights into
Burroughs's photographic practices, as well as
convincing evidence that his photographic work
should be considered a significant aspect of his
entire oeuvre. It includes portraits and
self-portraits, location shots from his travels in
Europe, the Americas, and North Africa,
photographs of construction and demolition
sites, and his individual and collaborative
experiments with photomontage, assemblage,
and collage.
Expo: 17/01/2014 - 6/4/2014, The
Photographers' Gallery, London
[UK] Prestel | Hardback | Eng. ed. | 280 x
240 mm | 140 p | 35 col.ill. | 125 bw ill. |
ISBN: 9783791348797 | € 42,00 [BE] / €
42,00 [NL] / € 42,00 [INT] | Jan. 2014
PHOTOGRAPHY
The Weegee Guide to New York
What is a Photograph?
Women Photographers
Roaming the City with Its Greatest Tabloid
Photographers
Carol Squiers
From Julia Margaret Cameron to Cindy
Sherman
During his storied career as the quintessential
New York photojournalist, Weegee explored the
city's least glamorous pockets. This unique
guide offers a series of excursions through
Weegee's stamping grounds, from the Bowery
to Midtown, the West Side to the East, and
with a little Brooklyn thrown in. Divided into
eleven neighborhood sections, it includes
contemporary and period maps to aid the
intrepid explorer or casual rambler as they
retrace Weegee's steps from murder scene to
car wreck to street fight.
[UK] Prestel | Flexi (Pb luxe) | Eng. ed. | 230
x 130 mm | 432 p | 5 col.ill. | 265 bw ill. |
ISBN: 9783791353555 | € 34,95 [BE] / €
34,95 [NL] / € 34,95 [INT] | May 2014
This book presents a wide variety of artists among them James Welling, Christopher
Williams, Uta Barth, Marco Breuer, Alison
Rossiter, Parker Ito, Sigmar Polke, and
Gerhard Richter - who have reconsidered and
reinvented the role of light, color, composition,
materiality, and subject in the art of
photography. Brought together for the first
time in book form, these individuals have
found new ways of implementing both analog
and digital technology, in many cases creating
hybrid works.
Expo: 24/01/2014 - 4/5/2014,
International Center of Photography, New
York
[UK] Prestel | Hardback | Eng. ed. | 275 x
235 mm | 224 p | 200 col. & bw ill. | ISBN:
9783791353517 | € 48,95 [BE] / € 48,95 [NL]
/ € 48,95 [INT]| Jan. 2014
This comprehensive volume features sixty of
the most important women photographers.
Each artist is profiled in spreads featuring
splendid reproductions of their key works and
an in-depth overview of their careers and
contributions to the art of photography.
Biographical information for each subject and a
contextual essay focusing on the impact of
women in the history of the medium makes
this an excellent illustrated reference.
[UK] Prestel | Hardback | Eng. ed. | 270 x 210
mm | 240 p | 200 col.ill. | ISBN:
9783791348148 | € 34,50 [BE] / € 34,50 [NL]
/ € 34,50 [INT]| April 2014
Richard Avedon
Sze Tsung Leong
Christine Turnauer
Photographs 1946-2004
Horizons
Presence
American photographer Richard Avedon
(1923-2004) received widespread acclaim for
his images in which he captured stars with
their "masks dropped" and their true colors
revealed. He was also notorious for the pitiless
way in which he created these moments.
Through his legendary project In the American
West, hundreds of his uncompromising
portraits of common people became
photographic icons. This large-format
publication presents over one hundred of his
most beautiful classic images.
A widening of our horizons: in his Horizons
series, the British-American artist Sze Tsung
Leong (* 1970 in Mexico City) combines
wide-angle photographs of landscapes from
throughout the world that exhibit fundamental,
formal similarities and rhythms by connecting
them with a common horizon line.
Unconventional juxtapositions allow the viewer
to transcend distances and boundaries and to
leap from the glacial lake of Jökulsárlón in
Iceland to the tropical Indian Ocean, ...
Christine Turnauer is a seeker, a wanderer
between the worlds. She has been interested in
the individuality and diversity of people since
her childhood. On her extended journeys
Turnauer tries to capture this moment of
absolute presence in her photographs. Without
artificial lighting and in front of a neutral,
preexisting background, each one of her
touching black-and-white portraits represents
an irrevocable encounter.
[G] Hatje Cantz | Hardback | Eng. ed. | 326 x
254 mm | 192 p | 128 col. & bw ill. | ISBN:
9783775737982 | € 58,00 [BE] / € 58,00 [NL]
/ € 58,00 [INT]| April 2014. New edition
[G] Hatje Cantz | Hardback | Eng. ed. | 272 x
340 mm | 160 p | 145 col. & bw ill. | ISBN:
9783775737890 | € 68,00 [BE] / € 68,00 [NL]
/ € 68,00 [INT]| March 2014
32
[G] Hatje Cantz | Hardback | Eng. ed. | 350 x
290 mm | 192 p | 91 col. & bw ill. | ISBN:
9783775737487 | € 49,80 [BE] / € 49,80 [NL]
/ € 49,80 [INT]| April 2014
PHOTOGRAPHY
Henri Cartier-Bresson
Here and Now
Chéroux
This lavishly illustrated monograph traces
Cartier-Bressons development as a
photographer, activist, journalist and artist. In
addition to some of Cartier-Bressons
best-known photographs, included here are
many seldom seen or unpublished images and
some rarities in colour as well as
black-and-white. He became renowned for his
penetrating portraits of the most prominent
figures of his time, becoming, in the words of
his biographer Pierre Assouline, the eye of the
century.
Expo: 12/02/2014 - 09/06/2014, Centre
G. Pompidou, Paris
[UK] T & H | Hardback | Eng. ed. | 210 x 150
mm | 416 p | 500 col. & bw ill. | ISBN:
9780500544303 | € 65,00 [BE] / € 65,00 [NL]
/ € 65,00 [INT]| March 2014
The Street Photographer's
Manual
Afghanistan
How to capture urban moments on phone,
camera or SLR
For thirty years, Afghanistan has known only
war. Renowned Magnum photographer Larry
Towell presents a moving and in-depth look at
the country, whose citizens and landscapes are
affected by conflict on a daily basis. Towell, a
veteran conflict reporter, has also worked in
Nicaragua, El Salvador, Mexico, Palestine, and
Israel. This work was shot between 2008 and
2011, offering a tour de force examination of
survival, exile, loss, and recuperation.
David Gibson
The reader is then introduced to twenty of the
most acclaimed international street
photographers, among them Bruce Gilden, Alex
Webb, Nils Jorgensen and Saul Leiter.
Integrated within the profiles are twenty fully
illustrated tutorials, including how to shoot a
face in a crowd and how to train your eye to
observe and capture the unexpected. This book
shows you that being a street photographer is
about looking for the luck. But luck requires
inspiration and that is where this book is
indispensable.
Photographs by Larry Towell
[US] Aperture | Hardback | Eng. ed. | 381 x
279 mm | 192 p | 350 col.ill. | ISBN:
9781597112666 | € 118,00 [BE] / € 118,00
[NL] / € 118,00 [INT]| July 2014
Only Firm sale
[UK] T & H | Paperback | Eng. ed. | 299 x 177
mm | 192 p | 100 col.ill. | ISBN:
9780500291306 | € 21,50 [BE] / € 21,50 [NL]
/ € 21,50 [INT]| May 2014
The Bikeriders
Rob Hornstra
Sally Mann
Danny Lyon
The Sochi Project: An Atlas of War and
Terrorism in the Caucasus
Immediate Family
Rob Hornstra and Arnold van Bruggen have
been working together since 2009 to tell the
story of Sochi, Russia, site of the 2014 Winter
Olympic Games. They have returned
repeatedly to this region as committed
practitioners of slow journalism, establishing a
solid foundation of research on and
engagement with this small yet incredibly
complicated place before it finds itself in the
glare of international media attention.
Expo: ,
Fotomuseum, Antwerpen
First published in 1992, Immediate Family has
been lauded by critics as one of the great
photography books of our time, and among the
most influential. Taken against the Arcadian
backdrop of her woodland summer home in
Virginia, Sally Mann's extraordinary, intimate
photographs of her children reveal truths that
embody the individuality of her own family yet
ultimately take on a universal quality. With
sublime dignity, acute wit, and feral grace,
Mann's pictures explore the eternal struggle .
First published in 1968, The Bikeriders explores
firsthand the stories and characters of the
Chicago Outlaws Motorcycle Club. The
journal-size title features original
black-and-white photographs and transcribed
interviews made from 1963 to 1967, when
Danny Lyon was a member of the Outlaws
gang. Authentic, personal, and
uncompromising, Lyons depiction of individuals
on the outskirts of society offers a gritty yet
humanistic view that subverts the
commercialized image of Americana.
[US] Aperture | Hardback | Eng. ed. | 235 x
159 mm | 94 p | 48 duotone ill. | ISBN:
9781597112642 | € 32,50 [BE] / € 32,50 [NL]
/ € 32,50 [INT]| April 2014
[US] Aperture | Hardback | Eng. ed. |300
x 240 mm | 512 p | ISBN: 9781597112444 |
€ 72,00 [BE] / € 72,00 [NL] / € 72,00 [INT]|
Nov. 2013
33
Reynolds Price
[US] Aperture | Hardback | Eng. ed. | 280 x
240 mm | 88 p | ISBN: 9781597112543 | €
50,00 [BE] / € 50,00 [NL] / € 50,00 [INT]|
March 2014
New edition
PHOTOGRAPHY
Expo:
6/2/2014 - 1/6/2014,
National Portrait Gallery, London
Bailey's Stardust
Introduction by Tim Marlow
Bailey's Stardust is a landmark exhibition of
portraits by one of the world's most
distinguished and distinctive photographers,
David Bailey.
Over 250 images, personally selected and
printed by Bailey, will be presented
thematically across a series of contrasting
rooms and will illustrate the extraordinary
range of subjects that he has captured
throughout his career: actors, writers,
musicians, filmmakers, designers, models,
artists and people encountered on his travels;
many famous, some anonymous
[UK] National Portrait Gallery | Hardback |
Eng. ed. | 330 x 254 mm | 272 p | 250 col. &
bw ill. | ISBN: 9781855144521 | € 72,00 [BE]
/ € 72,00 [NL] / € 72,00 [INT]| Feb. 2014
Box of Postcards
Bailey exposed
Bailey's
David Bailey
For this exclusive collection of postcards, David
Bailey, one of the worlds most distinguished
and distinctive photographers, has chosen a
selection of images from his archive some
familiar, others previously unseen. This box of
36 portraits, reminiscent of Baileys acclaimed
Box of Pin - Ups (1965), demonstrates the
extraordinary range of people that he has
captured during his long career; many of them
famous, some anonymous, all of them
unforgettable .
Drawing on numerous interviews, some
previously unpublished, and illustrated with
many iconic photographs as well as unseen
behind-thescenes images from Bailey's private
archive, this book explores the man behind the
camera. His outspoken and irreverent
observations on life, death, women, style,
fashion, sex, class, movies, the sixties,
photography, Photoshop, cowboy boots and
Hitler are as thought-provoking as they are
revealing.
[UK] National Portrait Gallery | Boxed | Eng.
ed. | 210 x 150 mm | 36 p | ISBN:
9781855144910 | € 21,00 [BE] / € 21,00 [NL]
/ € 21,00 [INT]| March 2014
[UK] National Portrait Gallery | Flexi (Pb luxe)
| Eng. ed. | 160 x 125 mm | 160 p | 80 col. &
bw ill. | ISBN: 9781855144668 | € 14,50 [BE]
/ € 14,50 [NL] / € 14,50 [INT]| Feb. 2014
34
PHOTOGRAPHY
Eve Arnold
Retrospective
edited by Dario Cimorelli
This book is dedicated to Eve Arnold
(Philadelphia 1912 - London 2012), one of the
major photographers of the XXth century, as
well as the first woman to become associated
with Magnum Photos in 1951 and then a full
member in 1957. Through one hundred and
twenty-eight black & white and color
photographs, we go through her long career,
during which she was equally comfortable
documenting the glamour of celebrities and
Hollywood stars - among whom Marilyn
Monroe, Joan Crawford, Liz Taylor, Marlene
Dietr
[IT] Silvana | Paperback with flaps | Eng./ Fr./
It. ed | 280 x 230 mm | 172 p | 172 col. & bw
ill. | ISBN: 9788836627936 | € 28,00 [BE] / €
29,95 [NL] / € 28,00 [INT]| Jan. 2014
América Latina 1960-2013:
Photographs
Texts by Olivier Compagnon, Luis Camnitzer
and Alfonso Morales Carrillo
The exhibition offers a new perspective on
Latin American photography from 1960 to
today, focusing on the relationship between
text and the photographic image. Bringing
together more than seventy artists from eleven
different countries, it shows the great diversity
of photographic practices. This catalogue of the
exhibition offers a vast panorama of the artistic
production of the last fifty years. Including
over 400 black-and-white and color
reproductions
Expo: 19/11/2013 - 6/4/2014, Fondation
Cartier, Paris
[UK] T & H, Distributed | Hardback | Eng. ed.
| 290 x 194 mm | 400 p | 1500 col. & bw ill. |
ISBN: 9782869251045 | € 46,00 [BE] / €
46,00 [NL] / € 46,00 [INT]| Jan. 2014
Mirror & Pomegranate
The Picture Collection
Works from the private archives of Andrey
Tarkovsky and Sergei Parajanov
Taryn Simon
Andrey Tarkovsky is considered by many to be
one of the greatest filmmakers the world has
ever seen. Although he made just eight feature
films before his life was cut tragically short by
cancer, at the age of 54, each is an artistic
masterpiece and a major landmark in world
cinema. This book presents a portfolio of
polaroids produced in association with the
Florencebased Tarkovsky Foundation archive,
which is maintained by the filmmaker's son
Andrey Tarkovsky. Taken in Russia and Italy
between 1979 and 1984
The Mid-Manhattan Library houses 1.29 million
prints, postcards, posters and images.
Organized by a complex cataloguing system of
over 12,000 subject headings, it is the largest
circulating picture library in the world. This
book highlights Simon's explorations into the
historic archive, and also offers a
newperspective on some of the greatest
20th-century artists, as she responds to
previously unseen archival material,
photographs and correspondence of artists
such as Diego Rivera, Lewis Hine, ...
Editions Cahiers d'Art
[UK] T & H, Distributed | Paperback | Eng. ed.
| 210 x 145 mm | 88 p | ISBN:
9780955739477 | € 17,95 [BE] / € 17,95 [NL]
/ € 17,95 [INT]| March 2014 -R/P
Text by Tim Griffin
[UK] T & H, Distributed | Paperback | Eng. ed.
| 336 x 254 mm | 404 p | 58 col.ill. | 187 bw
ill. | ISBN: 9782851171030 | € 124,00 [BE] /
€ 124,00 [NL] / € 124,00 [INT] | April 2014
35
Alexander Gronsky
Pastoral / Moscow Suburbs
In his photographic account Pastoral,
Alexander Gronsky portrays the outskirts of
Moscow: the places where humanity takes
refuge to find solace far from the cities,
colliding with urban expansion and frailty of
nature. The space explored lives in between,
suspended between the nothingness of the
unknown and what stands on the other side.
Gronsky is a landscape photographer with an
incredible ability to capture natural scenes with
an allegorical meaning: expanses and hills,
spectacular lights, broad horizons
Contrasto
[UK] T & H, Distributed | Hardback | Eng. ed.
| 300 x 260 mm | 112 p | 72 col.ill. | ISBN:
9788869654695 | € 43,50 [BE] / € 43,50 [NL]
/ € 43,50 [INT]| Jan. 2014
Taryn Simon
Born in New York in 1975, Taryn Simon is at
the forefront of contemporary photography
practice. Her artistic medium is based around
three equal elements, photography, text and
graphic design, which combined investigate the
limitations of absolute understanding,
examining the gaps between each element and
how this can lead to disorientation and
ambiguity. Published in close collaboration with
the artist, this brand-new book will provide a
complete overview of her practice to date.
[UK] Tate | Hardback | Eng. ed. | 270 x 150
mm | 216 p | 124 col.ill. | ISBN:
9781849762359 | € 42,00 [BE] / € 42,00 [NL]
/ € 39,80 [INT]| July 2014
PHOTOGRAPHY
Robert Mapplethorpe
Jean-Baptiste Mondino
Flowers
Smoking Permitted
Patti Smith
Michel Mallard
Among Mapplethorpe's "vintage" motifs
-nudes, portraits, black people, New York
homosexuals- flowers always had their place
illustrating the artist's overall theme: sexuality
stylized to still live.
Smoking Permitted by Jean-Baptiste Mondino,
grand maître of commercial photography, is a
pointed provocation to political correctness
reminiscing the days when smoking was not
considered a suicidal vice but a cultural habit of
elegance, coolness and allure.
[G] Schirmer/ Mosel | Hardback | Eng./ Germ.
ed. | 300 x 250 mm | 108 p | 50 col.ill. |
ISBN: 9783829606783 | € 33,00 [BE] / €
33,00 [NL] / € 33,00 [INT]| Feb. 2014
[G] Schirmer/ Mosel | Hardback | Eng. ed. |
315 x 240 mm | 300 p | 250 col.ill. | ISBN:
9783829606691 | € 88,00 [BE] / € 88,00 [NL]
/ € 88,00 [INT]| May 2014
Back to the Future
Irina Werning
We're all aware of getting older and may
obsess over how our bodies gradually change
with the years. Have you ever wanted to step
back a few years and reconnect with a younger
self? Would it be amusing or just plain creepy?
Back to the Future is a book by Argentinean
artist Irina Werning, who takes old pictures and
then mimics them years later with the subjects
dressed, styled, and posed exactly as they
were in the original. The results are quirky and
a fascinating insight into the aging process.
[G] teNeues | Hardback | Eng/ Fr/ Germ/
Span. ed. | 254 x 203 mm | 160 p | 144 col. &
bw ill. | ISBN: 9783832797263 | € 39,90 [BE]
/ € 39,90 [NL] / € 39,90 [INT]| May 2014
Brazil
Tim Flach. Evolution
Olaf Heine
Stern Portfolio no. 74
A Brazilian proverb states, "Those who leave
will take longing on their journeys." However,
translating saudade with "longing" doesn't do
the term justice. Olaf Heine's photographs
convey impressions that are hard to put into
words. Since 2010, the renowned portrait and
fashion photographer has captured the soul of
Brazil.
Tim Flach has built an exceptional reputation
for creating compelling images of animals that
captivate and enthrall photography buffs and
animal lovers alike. He combines artistic
originality with an intuitive genius for capturing
every creature's distinctive quirks and traits.
As he puts it himself, his work explores "how
we shape nature and how it shapes us." In
doing so, we see how our perceptions affect
the reality around us-highlighting the deep
bond we share with other members of the
animal kingdom.
[G] teNeues | Hardback | Eng./ Fr./ Germ. ed.
| 350 x 262 mm | 256 p | 150 duotone ill. |
ISBN: 9783832798130 | € 79,90 [BE] / €
79,90 [NL] / € 79,90 [INT]| April 2013
[G] teNeues | Hardback | Eng./ Germ. ed. |
360 x 270 mm | 96 p | 58 col.ill. | 11 bw ill. |
45 col. & bw ill | ISBN: 9783652001588 | €
18,00 [BE] / € 18,00 [NL] / € 18,00 [INT] |
Dec. 2013
36
PHOTOGRAPHY
John Cohen: Here and Gone
Raymond Depardon: Manicomio
Stan Douglas
Bob Dylan, Woody Guthrie & the 1960s
Selected Madness
John Cohen was a founding member of the
New Lost City Ramblers, one of the folk
revival's most authentic and respected musical
groups. In the 1960s he made a series of
photographs of the last years of Woody
Guthrie's life, and early portraits of Bob Dylan
on his arrival in New York, depicting two titans
of American music at opposite ends of their
careers. In the process, Cohen portrayed one
of the great moments of American folk music
history.
"In 1977, I met Franco Basaglia, director of the
manicomico (lunatic asylum) at the hospital in
Triest, who was also the leader of an
alternative psychiatric movement. Taking
advantage of the chaotic political situation in
Italy at the time, he started to close several
psychiatric hospitals with a group of doctors,
and had 'Law 180' passed in 1978, which
resulted in the definitive closure of the
asylums. Franco encouraged me to take
photographs of this reality, 'If not, they will not
believe us,' he told me
This publication highlights the significance of
the photographic image in the critical and
historical reception of Stan Douglas' approach
to art and media. The stories, sites and events
that Douglas explores are populist, literate and
timely. Frequently, his photographs describe
the overlooked histories of cultural identity,
displacement and injustice that reveal an
uncanny resemblance to present-day events.
[G] Steidl | Hardback | Eng. ed. | 240 x 240
mm | 152 p | 119 col.ill. | ISBN:
9783869306049 | € 46,00 [BE] / € 46,00 [NL]
/ € 46,00 [INT]| April 2014
[G] Steidl | | Eng. ed. | 305 x 248 mm | 159 p |
ISBN: 9783869307480 | € 69,95 [BE] / € 69,95 [NL]
/ € 69,95 [INT]| March 2014
[G] Steidl | Hardback | Eng. ed. | 220 x 295
mm | 208 p | ISBN: 9783869305356 | € 54,00
[BE] / € 54,00 [NL] / € 54,00 [INT]| Feb.
2014
Arthur Elgort
Mona Kuhn
Robert Polidori
The Big Picture
Private
Selected Works
This is Arthur Elgort's first comprehensive
book, showing his world-renowned fashion
imagery alongside his personal work. The book
spans Elgort's five-decade career and
illustrates his longevity as an emulated fashion
photographer. His lively and casual shooting
style is significantly influenced by a lifelong
love of music and dance, particularly jazz and
ballet.
For her fifth book with Steidl, Mona Kuhn has
entered the heart of the American desert and
returned with a sequence of pictures that is
seductive, enigmatic and a little unsettling.
Private proposes a world in which concrete
reality and the imaginary are one. Plants and
animals on the edge of survival, sun-drenched
landscapes and wind-sculpted earth are
intercut with a series of nudes that push
Kuhn's renowned sensitivity to human form
into unexpected directions.
Beirut. Tripoli. Havana. Chernobyl. New
Orleans. Rio. Amman. Versailles. Over the
course of thirty years, Robert Polidori has
travelled the world photographing. On the
occasion of his first museum retrospective in
the United States, the artist has selected more
than one hundred photographs for this volume
that challenge our preconceptions, mining both
the accoutrement and the psychology of space
for what they tell us -and for what they
withhold-about history, memory, identity, and
time.
[G] Steidl | Hardback | Eng. ed. | 320 x 245
mm | 424 p | 280 col.ill. | ISBN:
9783869305431 | € 96,50 [BE] / € 96,50 [NL]
/ € 96,50 [INT]| March 2014
[G] Steidl | Hardback | Eng. ed. | 297 x 310
mm | 112 p | 74 col.ill. | ISBN:
9783869307091 | € 54,00 [BE] / € 54,00 [NL]
/ € 54,00 [INT]| April 2014
37
[G] Steidl | Hardback | Eng. ed. | 320 x 290
mm | 228 p | 107 col.ill. | ISBN:
9783869306988 | € 54,00 [BE] / € 54,00 [NL]
/ € 54,00 [INT]| March 2014
PHOTOGRAPHY
Toy Stories
Tiny Tokyo
Photos of Children from Around the World and Their
Favorite Things
The Big City Made Mini
By Gabriele Galimberti
All the spectacular sights of the Tokyo landscape appear to have become
miniature! This pocket-sized volume collects incredible bird's-eye views
of Tokyo's bustling cityscape, shot using a tilt-shift photography
technique that has the effect of seeming to shrink its subject--making
one of the vastest cities in the world look like a miniature model. Epic
skyscrapers, crowded city streets and even sumo wrestling matches
shrink to the scale of tiny plastic toys in this one-of-a-kind impulse book.
For over a year, the photographer and journalist Gabriele Galimberti
visited more than fifty countries and created colourful images of boys
and girls in their homes and neighborhoods with their most prized
possessions: their toys. From Texas to India, Malawi to China, Miata, Fiji
and the Philippines, Galimberti recorded the spontaneous and natural joy
that unites kids despite their diverse backgrounds. Whether the child
owns a veritable fleet of miniature cars or a single stuffed monkey, the
pride that Galimberti captures is moving, funny and thought provoking.
[US] Chronicle Books | Flexi (Pb luxe) | Eng. ed. | 152 x 114 mm | 260
p | 180 col.ill. | ISBN: 9781452117386 | € 13,95 [BE] / € 13,95 [NL]
(CB)/ € 13,95 [INT]| Feb. 2014
[US] Abrams | Hardback | Eng. ed. | 229 x 229 mm | 112 p | 54 col.ill.
| ISBN: 9781419711749 | € 21,00 [BE] / € 21,00 [NL] (CB)/ € 21,00
[INT]| April 2014
38
PHOTOGRAPHY
Kate Moss
To more than one generation, Kate Moss is the
rebel queen, the model who made herself the
embodiment of the rock'n' roll spirit, the stylista
and the unconventional mother and wife.
In celebration of her 26-year career and 40th birthday
in January 2014, this book looks back at her life in
beautiful images and revealing text.
[UK] Carlton | Hardback | Eng. ed. | 237 x
185 mm | 144 p | 120 col. & bw ill. | ISBN:
9781780974576 | € 24,50 [BE] / € 24,50 [NL]
/ € 24,50 [INT]| Jan. 2014
Avedon: Women
Joan Juliet Buck, Abigail Solomon-Godeau
Over his sixty-year career, photographer
Richard Avedon was renowned for his
distinctive, transformative eye. Women were
often his subject, through his commercial
fashion work for Harper's Bazaar and Vogue,
and in his portraiture of both the famous and
the unknown. What might have been pictured
as prosaic or unattractive through another
photographer's lens was presented by Avedon
as unconventional but surprising, sometimes
revelatory.
[US] Rizzoli | Paperback | Eng. ed. | 393 x
304 mm | 200 p | 120 bw ill. | ISBN:
9780847842810 | € 95,00 [BE] / € 95,00
[NL] / € 95,00 [INT]| Jan. 2014
39
COOKERY
Zelfgeplukt en zelfgemaakt,
dat smaakt!
Gezondig koken met Stephanie
Coorevits
In dit boek komen een aantal Vlaamse
zelfpluktuinen/CSA in the picture met de hele
range aan fruit, groenten, kruiden en eetbare
bloemen die ze aanbieden, gedicteerd door de
seizoenen. Allerlei soorten bessen, vergeten
groenten, kruiden met klinkende namen en
speciale kruisingen die tot de verbeelding
spreken. Een ware weldaad voor het oog, de
smaakpapillen en de gezondheid!
Stephanie Coorevits
Stephanie Coorevits' keuken is een synthese
van haar twee grootste liefdes: die voor eten
en de liefde voor haar Cypriotische man
Simeon. Kort gezegd gaat dit boek over
'gezondig eten', een balans vinden tussen
enerzijds wat goed is voor ons lichaam en
anderzijds wat misschien niet écht goed is
maar toch té lekker om volledig van het menu
te schrappen. Over durven experimenteren met
dingen die minder bekend zijn en je dagelijkse
kost een vleugje exotiek meegeven. Maar het
gaat vooral over heerlijk eten.
[BE] Stichting Kunstboek | Paperback | NL ed.
| 240 x 170 mm | 144 p | 120 col.ill. | ISBN:
9789058564863 | € 19,95 [BE] / € 19,95 [NL] /
€ 19,95 [INT]| May 2014
[BE] Stichting Kunstboek | Hardback | NL ed.
| 250 x 210 mm | 160 p | ISBN:
9789058564856 | € 24,95 [BE] / € 24,95 [NL]
/ € 24,95 [INT]| May 2014
De Tafel van 10
Biergastronomie in de Westhoek
Eenvoudige gerechten met een feestelijk
resultaat
't Hommelhof in Watou
Het uitgangspunt van het boek is 'zorgeloos
koken voor een groter gezelschap', met andere
woorden: samen met je gasten genieten van
heerlijke gerechten zonder al te veel poespas
en stress.
De sfeer is casual, gezellig, de culinaire insteek
is easy self made en authentiek. De recepten
zijn zeer haalbaar, snelklaar en worden bereid
met courant verkrijgbare producten. Eerst licht
Lieve haar lievelingsproducten en voorraadkast
toe, daarna komen er een 36-tal gerechten
ingedeeld per seizoen.
In dit boek combineert de pionier van de
Belgische bierkeuken zijn favoriete lokale
ingrediënten - zoals hoppescheuten, duif,
vergeten groeten, lam, biokip, foie d'oie en
kazen - met een vijftigtal bieren uit zijn regio.
Zoon Simon ontpopte zich tot hobbybrouwer
en biersommelier en koos een passend biertje
voor elk gerecht.
[BE] Stichting Kunstboek | Hardback | NL ed.
| 240 x 170 mm | 176 p | 120 col.ill. | ISBN:
9789058564870 | € 24,95 [BE] / € 24,95 [NL]
/ € 24,95 [INT]| June 2014
Cooking with Belgian Beers
Stefaan Coutteneye
[BE] Stichting Kunstboek | Hardback | NL ed.
| 230 x 230 mm | 144 p | 100 col.ill. | ISBN:
9789058564764 | € 29,95 [BE] / € 29,95 [NL]
/ € 29,95 [INT]| Dec. 2013
[BE] Stichting Kunstboek | Hardback | Eng. ed. |
230 x 230 mm | 144 p | ISBN: 9789058564832 |
€ 29,95 [BE] / € 29,95 [NL] / € 29,95 [INT]|
March 2014
40
COOKERY
Mange Bruxelles
Un peu plus qu'un livre de cuisine
Nutrition gourmande autour de la
naissance
Corinne Hubinont, Françoise De Keuleneer,
Héloïse Coppée
25 restaurants, 15 anciens, 12 nouveaux
(2ème édition)
Choisir une alimentation adaptée à la fertilité,
à la grossesse et à l'allaitement : c'est
aujourd'hui possible.
101 recettes créatives, gourmandes et
conviviales les rendent aisés à suivre au
quotidien, dès le désir de grossesse : jus,
crudités, soupes, sauces, plats végétariens,
repas de poisson et de viande, desserts, autant
de suggestions à combiner avec plaisir au gré
des saisons.
René Sépul. Cici Olsson (photography)
Ce livre s'adresse à la fois aux futurs parents et
aux professionnels de la santé.
Ce livre présente une vingtaine de restaurants
de Bruxelles. Ces restaurants sont différents
les uns des autres : certains sont étoilés
(Comme Chez soi, Bon Bon, Senza Nome),
d'autres ne le sont pas et ne veulent pas l'être
(Vini Divini, Coin des Artistes, Viva M'Boma).
Certains sont tenus par de très jeunes chefs
(Jaloa, La Buvette), d'autres par de plus
anciens (Notos - Chou). Chaque chef est
présenté par des habitués, un portrait du chef,
et une présentation des recettes les mieux
adaptées à son style.
[BE] Ed. Françoise Blouard | Paperback |
French ed. | 220 x 201 mm | 240 p | ISBN:
9782875100214 | € 29,00 [BE] / € 29,95 [NL]
/ € 29,00 [INT]| Oct. 2013
[BE] Sh-op Editions | Hardback | French ed. |
240 x 170 mm | 288 p | throughout col.ill. |
ISBN: 9782960093353 | € 29,50 [BE] / €
29,50 [NL] / € 27,83 [INT]| April 2014
Annoncé:
Bruxelles pour un homme
René Sépul
[BE] Sh-op Editions | Paperback | French ed. |
230 x 160 mm | 224 p | throughout col.ill. |
ISBN: 978296009360 | € 29,50 [BE] / € 31,50
[NL] / € 29,50 [INT]| March 2014
Couleur Santé
Gezonde Kleur
Les secrets de la cuisine antioxydante
Koken met Antioxydanten -promo prijs-
Françoise De Keuleneer, Joël Pincemail,
Jean-Pierre Gabriel
Françoise De Keuleneer, Joël Pincemail,
Jean-Pierre Gabriel
Savez-vous que la couleur des fruits et des
légumes est le reflet des défenses qu'ils ont
élaborées pour se protéger contre les effets
toxiques de la lumière et de l'oxygène? Et que
ces couleurs se traduisent très concrètement
par une gamme d'antioxydants dont notre
organisme a besoin pour lutter contre les
agressions de la vie moderne : stress,
pollution, malbouffe...
Soep van zoete aardappelen met limoengras en
gember; tartaar van tomaten met olijven en
pijnappel; salade van rode kool en rode biet
met appel en noten; spiesjes van lotte met
jonge erwtjes, koriandersaus, citrusvruchten en
limoengras; een roze gelei van rode vruchten.
In Gezonde Kleur krijgt u, in een eenvoudige
taal, een actuele stand van zaken in het
onderzoek rond natuurlijke antioxidanten en
wordt dit ook naar de praktijk omgezet met
een 60-tal recepten, rijk aan smaak en kleur !
[BE] Ed. Françoise Blouard | Paperback |
French ed. | 220 x 201 mm | 216 p | 120
col.ill. | ISBN: 9782875100221 | € 29,00 [BE]
/ € 31,00 [NL] / € 29,00 [INT]| Oct. 2013
(Nouvelle édition nouveau format)
[BE] Ed. Françoise Blouard | Hardback | NL
ed. | 260 x 210 mm | 208 p | 85 col.ill. |
ISBN: 9782960048780 | € 19,50 [BE] / €
19,50 [NL] / € 19,50 [INT]| April 2008
Promoprijs vanaf 1/10/2013:
39,50 euro !
19,50 euro ipv
COOKERY
Ellemieke's familie kookboek met
knutselboek Beet
De keuken van ons vader
Mannen koken voor familie en vrienden
(set 2 vol)
Ann Olaerts. Photography: Tony Le Duc
Dit boek gaat over 'vaders die graag achter het fornuis staan en in de
potten roeren voor de familie en vrienden'.
Want niet alleen de moeders zijn keukenprinsessen, ook vaders staan
aardig hun mannetje in de keuken.
Twee boeken samen. Een kookboek voor de ouders en een Doe-Boek
voor de kinderen. Terwijl mama (of papa) het eten klaarmaakt, gaan de
kinderen aan de slag met knutselen.
Ellemieke Vermolen, echtgenote van chefkok Sergio Herman toont met
dit duo boeken het voorbeeld. Zij kookt gezond, eenvoudig en lekker
voor haar gezin terwijl de kinderen zich niet vervelen.
Vaders, uit alle windstreken van het land en van alle leeftijden vertellen
hun culinaire verhaal aan journaliste An Olaerts en maken hun favoriete
gerechten klaar voor de cameralens van Tony Le duc.
Net zoals bij de moeders, wordt dit boek een werkelijke weergave van
hoe onze vaders koken, zonder moderne styling en gefotografeerd op
hun eigen borden en tafellakens. Zoals het echt is. Een ode aan de
vaders, die toch weer héél anders koken dan de moeders.
Ellemieke Vermolen is haar hele leven al passioneel met eten bezig. Zij is
een familiebeest en haar grootste rijkdom is om eenvoudig en lekker te
koken en met het gezin samen te zijn. In dit boek toont ze hoe ze haar
kinderen gezond doet eten en van welk gerecht ze beter slapen. Haar
gerechten zijn met liefde bereid. Of wil je niet weten met welk gerecht zij
Sergio Herman's hart heeft gewonnen. Toch?
[BE] Minestrone
Dit kookboek vormt een duo met het Doe-Boek BEET. Terwijl mama
kookt, kunnen de kinderen een knutselwerk maken om de tafel te
versieren, om de keuken mooier te maken of om oma te foppen.
[BE] Minestrone | Hardback | NL ed. | 265 x 200 mm | 320 p | 170
col.ill. | ISBN: 9789490028503 | € 35,00 [BE] / € 35,00 [NL] (CB)/ €
35,00 [INT]| Oct. 2013
[BE] Minestrone
[BE] Minestrone | 2 Volumes | NL ed. | 280 x 200 mm | 176 p |
throughout col.ill. | ISBN: 9789490028596 | € 29,50 [BE] / € 29,50
[NL] (CB)/ € 29,50 [INT]| Dec. 2013
42
COOKERY
Ferran Adria and El Bulli
The Art, the Philosophy, the Gastronomy
In July 2011, Adria closed El Bulli in order to
revolutionize not the art of cooking but his art
of cooking, with plans to open a creativity
centre for chefs and launch LaBullipedia - "a
Western haute cuisine Wikipedia at the service
of information but also creativity". With superb
photographs by Francesc Guillamet, the book
evocatively pictures the experimental culinary
creations of Ferran Adria, artist-chef.
Fictitious Dishes:
An Album of Literature's Most Memorable Meals
Dinah Fried
Pairing approximately 50 charming photographic re-creations
of meals from classic and contemporary literature-all prepared,
styled, and shot by the author-with relevant excerpts, this innovative
gift book is sure to captivate legions of literature lovers,
foodies, design junkies, and photo geeks.
[UK] Carlton | Hardback | Eng. ed. | 242 x
204 mm | 160 p | ISBN: 9780233003832 |
€ 28,95 [BE] / € 28,95 [NL] / € 28,95 [INT]
| June 2013
Featuring iconic book covers, illustrations, and atmospheric food
shots, Fictitious Dishes presents 50 new pairings in an eye-catching
format. To enhance the readers' experience, interstitial spreads
throughout the book provide visual variety and cover culinary
themes, including excerpts from additional works on topics ranging
from "apple pie" to "chocolate," anecdotes about writers with a
ppetites both healthy and spartan, writers' culinary predilections,
fun facts about featured foods and their preparation in the context
of the given era. Among the highlighted meals are:Nieuwe tekst
[US] Collins US | Hardback | Eng. ed. |
210 x 149 mm | 128 p | ISBN: 9780062279835 |
€ 19,99 [BE] / € 19,99 [NL] / € 19,99
[INT]| April 2014
French Wine
An Illustrated Miscellany
This truly exceptional miscellany of anecdotes,
facts, quotable quotes, and interesting stories
celebrates wine in all its guises: from the
mythical origin of the toast (it was customary
for guests to tip part of their drink into their
companions glass to prevent being poisoned at
a dinner) to the exact number of references to
wine in the Bible (441) ... Through quotes
illustrating how traditions persist this
exquisitely produced volume is the perfect gift
for the wine aficionado or bon vivant.
[F] Flammarion (Eng) | Hardback | Eng. ed. |
240 x 190 mm | 256 p | throughout col. & bw
ill. | ISBN: 9782080201546 | € 32,50 [BE] / €
32,50 [NL] / € 32,50 [INT]| April 2014
43
GARDENS & LANDSCAPE DESIGN
Handmade for the Garden
75 Ingenious Ways to Enhance Your
Outdoor Space with DIY Tools, Pots,
Supports, Embellishments, and More
By Susan Guagliumi
De Kleine Kweek
De Tuindokter - Stefaan Bingé
Zin in een vruchtbaar mini-moestuintje maar
geen grond? Geen probleem, in dit boek leer je
dat een gevel, een dak of een koertje volstaan!
Microtuinieren is beslist de toekomst. Alles is
mogelijk, bloemen, vaste planten, bomen, klein
fruit, kruiden en groenten...
In dit boek komen in verschillende
hoofdstukken de diverse wijzen van
microtuinieren aan bod: daktuinen,
geveltuinen, stadstuinen, kamertuinen,
pottuinen, balkontuinen, hangende tuinen,
woestijntuinen, beweegbare tuinen.
[BE] Stichting Kunstboek | Paperback | NL ed.
| 230 x 170 mm | 176 p | ISBN:
9789058564894 | € 19,95 [BE] / € 19,95 [NL]
/ € 19,95 [INT]| April 2014
Vertical Gardens
Be in a Treehouse
A thorough technical introduction provides
guidance to architects and designers exploring
vertical gardens, an innovative and ever more
popular response to increasing urbanization.
This book features the most exciting projects
from around the world, illustrated with full
color photographs, plans and in-depth
explanations from the architects. It will be an
inspiration to architects, students and those
interested in urban design.
Design / Construction / Inspiration
[ES] Links (tbs) | Hardback | Eng. ed. | 284 x
242 mm | 300 p | 678 col.ill. | ISBN:
9788415492795 | € 55,00 [BE] / € 55,00 [NL]
/ € 51,89 [INT]| March 2014
Pete Nelson
Pete Nelson, the world's best-known treehouse
designer and builder, wants to put readers in
trees--his motto is, "get 'er done, so you can
BE in a TREE." His new book is a
comprehensive source of inspiration and
practical information about treehouse design
and construction. To that end, he explains the
basics of treehouse construction with his own
recent projects as case studies.
[US] Abrams | Hardback | Eng. ed. | 286 x
191 mm | 224 p | 237 col.ill. | 39 bw ill. |
ISBN: 9781419711718 | € 31,50 [BE] / €
31,50 [NL] / € 31,50 [INT] | April 2014
44
The DIY craze has moved beyond the craft
room, into the kitchen and outside to the
garden. In Handmade for the Garden, Susan
Guagliumi shares a treasure trove of original
projects that she has been perfecting over the
last 10 years in her garden. Relying on
easy-to-find and repurposed materials,
Guagliumi presents projects that not only make
planting and growing efficient and successful
but also add a personal touch to the
garden-scape.
[US] S.T.C. | Paperback with flaps | Eng. ed.
| 254 x 210 mm | 208 p | 100 col.ill. | 140 bw
ill. | ISBN: 9781617690976 | € 23,50 [BE] / €
23,50 [NL] / € 23,50 [INT] | March 2014
Atlas of World Landscape
Architecture
Markus Sebastian Braun & Chris van Uffelen
This compendium is a reference book and
source of inspiration in one, presenting around
350 current projects from around the world.
They range from expansive natural and
cultivated landscapes, via picturesque front
yards and courtyards, spectacular greened
facades and roofs, up to innovative outdoor
designs that nearly or completely make do
without any vegetation.
[G] Braun | Hb with slip case | Eng. ed. | 330
x 240 mm | 512 p | 1500 col.ill. | ISBN:
9783037681664 | € 99,95 [BE] / € 99,95 [NL]
/ € 99,95 [INT]| April 2014
FLOWER ART
Life3 - Interior Emotions
Per Benjamin, Tomas De Bruyne, Max van de
Sluis
Dankzij het cocoonen en het gehypte DIY-en,
knutselen en upcyclen wordt onze woning
steeds meer een warm nest en een speeltuin
voor creatieve geesten die met enkele
kleurrijke accenten dat nestgevoel nog wat
vergroten. Ook planten en bloemen zijn
geliefde smaakmakers in het interieur en of je
nu houdt van Scandinavisch design of klassiek
romantisch, er zijn bloemen en combinaties
voor elke interieur. Interior Emotions bevat een
schat aan stijlvolle bloemaccenten voor
binnenshuis.
Whispering Flowers - Ikebana
Wispering Flowers wil Ikebana arrangementen
tonen geïnspireerd door de schoonheid van één
enkele soort bloemen. Hun typische kleuren,
lijnen, vormen en betekenissen dicteren de
vormen, materialen en kleuren van de
schikkingen. Deze aanpak, waarbij bloemen
zelf de hoofdrol spelen en geen voorafbepaald
concept aan de basis van een schikking ligt,
geeft aanleiding tot een grote diversiteit aan
traditionele als meer eigentijdse werken en
zowel kleinschalige als grote Land Art stukken.
[BE] Stichting Kunstboek | Hardback | Eng.
ed. | 290 x 240 mm | 160 p | ISBN:
9789058564801 | € 59,90 [BE] / € 59,90 [NL]
/ € 59,90 [INT]| March 2014
[BE] Stichting Kunstboek | Hardback | Eng.
ed. | 330 x 245 mm | 160 p | 100 col.ill. |
ISBN: 9789058564191 | € 59,90 [BE] / €
59,90 [NL] / € 59,90 [INT]| Jan. 2014
International Floral Art
2014-2015
About Flowers
Lut Verkinderen
About Flowers biedt niet alleen inspiratie, maar
is bovenal een werkboek voor alle seizoenen en
gelegenheden. Toegankelijke creaties in een
eigentijdste stijl met pittige kleuraccenten zijn
het handelsmerk van Lut Verkinderen. Een
jeugdige en up-to-date stijl die zonder twijfel
zowel de beginnende als de gevorderde florist
zal kunnen bekoren.
[BE] Stichting Kunstboek | Hardback | Eng./
NL ed. | 235 x 235 mm | 120 p | 100 col.ill. |
ISBN: 9789058564788 | € 24,95 [BE] / €
24,95 [NL] / € 24,95 [INT]| Nov. 2013
Jubilee edition
Meer dan eens kreeg opgemerkt jong talent
aan het begin van een beloftevolle carrière net
dat extra zetje om internationaal door te
breken. Het boek is ook een perfecte
networking tool die ons in contact bracht met
vele internationale scholen voor
bloemsierkunst. Na tien jaar is het daarom de
hoogste tijd om deze unieke publicatie zelf
eens in de bloemtjes te zetten, en dat doen we
met een feestelijke jubileumuitgave, zoals
steeds tjokvol verrassend en innovatief floraal
werk.
[BE] Stichting Kunstboek | Hardback | Eng.
ed. | 290 x 240 mm | 304 p | 280 col.ill. |
ISBN: 9789058564665 | € 59,90 [BE] / €
59,90 [NL] / € 59,90 [INT]| Feb. 2014
45
ARCHITECTURE
Juliaan Lampens
Angélique Campens
The architecture of the Belgian Modernist
Juliaan Lampens (°1926) goes beyond designs
for conventional living and instead suggests a
utopian avant-garde of living without barriers.
He experimented with the use of raw concrete
and created sculpture-like exteriors leading
onto open vistas.
Edited by Angelique Campens - With
contributions by Angelique Campens, Sara Noel
Costa De Araujo, Joseph Grima, Jan
Kempenaers, Hans Ulrich Obrist and Francis
Strauven.
[BE] AsaMER | Paperback | Eng. ed. | 275 x
210 mm | 152 p | ISBN: 9789461170057 | €
29,50 [BE] / € 29,50 [NL] / € 27,83 [INT]|
April 2014
Herdruk - Reprint
dmvA Architecten
Behind the Green Door
The Port Office
A Critical Look at Sustainable Architecture
Through 600 Objects
The Art and Architecture of European Port
Authorities
Some thing about some things Some
thinking
Behind the Green Door is a richly illustrate
critical portrait of today's green wave in
architectural design. Embracing a
transdisciplinary outlook, the book addresses
the concrete consequences and paradoxes of
the building industry's current striving for
sustainability. It deliberately suspends the
quest for sustainability in order to map and
comment on the forces operating in the field.
Patrick Verhoeven (ed.)
Dominique Pieters e.a.
The evolving role of port authorities can be
traced through the architecture of their
haedquarters. Prestigious city palaces tended
to mark the vested power that fitted the
historical, all-encompassing role of port
authorities, whereas contemporary architecture
displays a more functional and
business-oriented profile.
Other port authorities established themselves
in former warehouses or passenger terminals,
thus connecting with the industrial heritage of
their ports.
De visie van het Antwerpse architectenbureau
dmvA leest als een pamflet. Tom Verschueren
en confrater David Driesen als revolutionairen
te boek stellen is misschien een brug te ver,
maar toch drukt dmvA architecten steeds meer
en vooral een onuitwisbare stempel op de
private en publieke architectuur in België. Het
acroniem dmvA - door middel van Architectuur
- dekt een ruime lading waarin 'maximaal
minimalisme' misschien wel de gemene deler
is. Het pragmatische-conceptueel minimalisme
van dmvA is charmant,
[BE] Pandora | Hardback | Eng. ed. | 250 x
250 mm | 132 p | throughout col.ill. | ISBN:
9789053253656 | € 34,95 [BE] / € 34,95 [NL]
/ € 37,30 [INT]| Nov. 2013
[BE] Stichting Kunstboek | Hardback | Eng.
ed. | 220 x 168 mm | 160 p | 150 ill. | ISBN:
9789058564818 | € 29,95 [BE] / € 29,95 [NL]
/ € 29,95 [INT]| May 2014
Oslo Architecture Triennale
[BE] Rotor | Paperback | Eng. ed. | 240 x 170
mm | 300 p | ISBN: 9788299937016 | € 28,00
[BE] / € 28,00 [NL] / € 26,42 [INT]| April
2014
46
ARCHITECTURE
Scenes from Luchtbal -
Bewegende landschappen
Whatever happens to the modernist city?
Over film en stedenbouw (incl DVD)
Lianne Verstrate, Bruno De Meulder, Frank
Moulaert, Joeri De Bruyn (eds.), Photography:
Lavinia Wouters
Sofie De Caigny en Ellen Van Impe (eds.)
Van de propaganda vermomd als documentaire
van Charles Dekeukeleire, over een kritische
insteek verpakt als fictie van Luc De Heusch,
tot de doorwrochte en eigengereide
opiniestukken van Jef Cornelis: cineasten
blijken zowel een verhelderende als
onthutsende kijk op het landschap te hebben.
Bewegende Landschappen bundelt vier unieke
films op DVD. Het bijhorende boek bevat
stukken van Michiel Dehaene, Bruno
Notteboom, Michael Ryckewaert en Sofie De
Caigny.
V.A.I. / CVAa
What would happen if Luchtbal were to be
perceived as one big opportunity, instead of an
assemblage of independent and problematic
components? This unusual neighbourhood in
northern Antwerp is the subject of the
transdisciplinary research efforts and design
explorations collated in this book. Locked
between the harbour, motorways and the
canal, Luchtbal is a veritable open-air museum
of the modernist city, a place in which form
follows function.
[BE] Public Space | Paperback with flaps |
Eng. ed. | 220 x 170 mm | 144 p | ISBN:
9789491789014 | € 16,00 [BE] / € 16,00 [NL]
/ € 15,09 [INT]| Dec. 2013
[BE] VAi | Paperback | NL ed. |210 x 148 mm |
120 p | ISBN: 9789081326391 | € 25,00 [BE] /
€ 25,00 [NL] / € 23,58 [INT]| Feb. 2014
Somewhere City
Interior One
Een stadsportret van Genk
François Hannes
Pascal Verbeken, Jimmy Kets
François Hannes. Photography: Alfons Lenders
Kan je een stad lezen zoals een boek? Pascal
Verbeken (auteur van Le Grand Central Belge
en ArmWallonië) doorkruiste de mozaïekstad
Genk te voet, met de fiets, trein en een auto.
Het landschap van Genk leest zich als de
geschiedenis van de 20ste eeuwse
industrialisatie. Elke gevel is een verhaal. Genk
is een facetstad zonder historische kern. De
stadsdelen liggen ver uit elkaar en kennen hun
eigen specifieke geschiedenis.
Francois Hannes is gepassioneerd en gedreven
door schoonheid. Hij houdt van het goede
bourgondische leven. De rust van een
landschap, de natuur, maar ook de dynamiek
van een metropool inspireren en prikkelen
hem. Niet de tussenweg, maar juist de
uitersten zoekt hij op.
Deze ingrediënten komen terug in zijn werk.
Zijn ontwerpen zijn weloverwogen, sereen en
lopen op een natuurlijke wijze in elkaar over.
Het ontbreekt echter nooit aan spannende of
gewaagde details.
[BE] VAi | Paperback| NL ed. | 65 p | ISBN:
9789082122503 | € 9,50 [BE] / € 9,95 [NL] /
€ 9,50 [INT]| Oct. 2013
[BE] Stichting Kunstboek | Hardback | Eng./
NL ed. | 290 x 290 mm | 252 p | 200 col.ill. |
ISBN: 9789058564726 | € 49,90 [BE] / €
49,90 [NL] / € 49,90 [INT]| Dec. 2013
47
ARCHITECTURE
Libraries
Spaces for Children
Innovative Office Design
Innovation & Design
Carles Broto
Carles Broto
The role of libraries in society has changed and
evolved in recent years, with the increasing
importance of online sources. Modern libraries
must strike a balance between housing
significant amounts of printed material,
providing access to digital material, and
serving as a hub of activities within the
community, whether that community is a
neighborhood of a city, or a specific field of
study at a university.
The wide range of projects presented in this
volume constitutes a comprehensive study of
the latest trends in the architecture and design
of children's spaces. Each project presents an
innovative use of materials, color, lighting and
texture to form a space that is stimulating,
educational and safe for young people. Both
established architecture firms and rising stars
have contributed to this stellar collection of the
best in child-friendly design.
[ES] Links (tbs) | Hardback | Eng. ed. | 284
x 242 mm | 300 p | 484 col.ill. | 131 bw ill. |
ISBN: 9788415492955 | € 55,00 [BE] / € 55,00
[NL] / € 55,00 [INT] | March 2014
[ES] Links (tbs) | Hardback | Eng. ed. | 284
x 242 mm | 300 p | 499 col.ill. | 105 bw ill. |
ISBN: 9788490540343 | € 55,00 [BE] / € 55,00
[NL] / € 55,00 [INT] | April 2014
This volume brings together the most
innovative office projects in recent years,
designs that revolutionize the way work is
being done today. With new materials and
design concepts, a heightened awareness of
ecological responsibility, and changing ideas of
what fosters creativity and motiva-tion at
work, the projects chosen for this book
represent ongoing develo-pments. With
full-color photographs, detailed illustrations,
sketches and plans accompanied by in-depth
texts by the architects themselves.
[ES] Links | Hardback | Eng. ed. | 284 x 242
mm | 300 p | throughout col.ill. | ISBN:
9788415492856 | € 55,00 [BE] / € 55,00 [NL]
/ € 51,89 [INT]| Nov. 2013
Tropical Resorts
Eduardo Broto
Modern House in Denmark
Traditional craftsmanship and a high degree of
quality influenced both design and architecture
in Danish Modernism. This is a compendium of
selected buildings in detail, including icons such
as Utzon House by Jørn Utzon, Arne Jacobsen's
Siesby House, or the Bøgh Andersen House by
Jørgen Bo and Vilhelm Wohlert. It includes
new, four-color photographs that document the
buildings as well as discussions on the history
of each one's design and construction.
[G] Hatje Cantz | Hardback | Eng. ed. | 275 x
245 mm | 336 p | 491 col. & bw ill. | ISBN:
9783775738033 | € 39,80 [BE] / € 39,80 [NL]
/ € 39,80 [INT]| March 2014
Presenting a series of flawlessly-designed
tropical resorts that are the final word in
luxury, Tropical Resorts is a must-have for
architects, those interested in hotel design, or
anyone in need of a holiday. Featuring a
selection of the most glorious tropical retreats,
from the Maldives to Thailand, this book is a
unique and inspiring resource for designers and
students alike. Projects are illustrated with
appealing full-color photographs and in-depth
descriptions of everything you could be doing
on holida
[ES] Links | Hardback | Eng. ed. | 284 x 242
mm | 300 p | 680 col.ill. | 80 bw ill. | ISBN:
9788415492788 | € 55,00 [BE] / € 55,00 [NL]
/ € 51,89 [INT] | March 2014
Including 80 b/w plans & drawings
48
ARCHITECTURE
Model Making
Tegendraads Modern
Think Dutch
Conceive, Create and Convince
Een bevrijdend alternatief voor de strenge
Goed Wonen norm.
Conceptual Architecture & Design in the
Netherlands
André Koch
In deze publicatie wordt het begrip
Tegendraads Modern' gelanceerd als
tegenhanger van het jaren vijftig
(neo-)modernisme van Goed Wonen. Het
betreft die vorm van moderniteit in de
vormgeving voor de wooncultuur die
ternauwernood een plek heeft gekregen in de
openbare collecties met een designafdeling.
Toch is het de stijl van vormgeven die we
onmiddellijk en gewoonlijk associëren met de
vijftiger jaren.
Jonge Nederlandse ontwerpers en architecten
werken graag in interdisciplinaire collectieven,
en benadrukken de ethische en esthetische
waarden van hun vak. Het boek groepeert het
werk van de nieuwe creatieve generatie in 16
hoofstukken met titels als "Build on Water",
"Celebrate Food", "Don't Create for Eternity" en
"Get Educated". Vragen die gesteld worden zijn
onder andere: "Zorgt dit design voor nieuwe
inzichten? ", "Wanneer kun je biologisch
afbreekbare materialen gebruiken in
architectuur?" ...
[NL] Scriptum Art | Hardback | NL ed. | 280 x
220 mm | 240 p | throughout col.ill. | ISBN:
9789055948710 | € 34,50 [BE] / € 34,50 [NL]
/ € 36,60 [INT]| Feb. 2014
[NL] Frame | Hb with slip case | Eng./ NL ed. |
280 x 240 mm | 400 p | throughout col.ill. |
ISBN: 9789491727245 | € 125,00 [BE] / €
125,00 [NL] / € 125,00 [INT]| Dec. 2013
Bernard Otte, Arjan Karssen
This book is a step-by-step guide about how to
create convincing architectural models. Borne
out of the authors' experience and enjoyment
in the use of models in education and in
professional practice, it is an essential manual
for students of spatial disciplines, such as
urban planning, garden and landscape
architecture, public space or interior design,
and anyone with an interest in model making.
[NL] Frame | Paperback | Eng. ed. | 210 x
245 mm | 208 p | ISBN: 9789491727276 | €
29,00 [BE] / € 29,00 [NL] / € 29,00 [INT]|
May 2014
Hardcover in acrylic slipcase
Mario Botta
Architecture and Memory
This monographic and richly illustrated catalogue
is published on this occasion; it concentrates
on four themes out of a wide range of
Mario Botta's activity and realized work: the l
ibraries, the museums, the theaters and the
sacred buildings.Themes, that express in their
particular way the idea of "spaces of memory".
The book also includes essays.
Expo: 30/1/2014 - 25/7/2014, North Carolina
Bechtler Museum of Modern Art, Charlotte
[IT] Silvana | Paperback with flaps | Eng. ed. ,
280 x 240 mm | 272 p | 515 col.ill. |
172 col. & bw ill | ISBN: 9788836627998 |
€ 40,00 [BE] / € 42,40 [NL] / € 37,74 [INT]|
Feb. 2014
49
INTERIOR DESIGN 1 TRAVEL
Cool Cities Berlin
Cool Cities New York large
There's something for every taste among
This illustrated book features spectacular
images of the city that never sleeps
New York has long set the trends in culture
and lifestyle and all of its most intriguing
destinations can be found among these pages
Shows how you can embark on a culinary
trip around the world without ever leaving New
York
the numerous recommendations for shops,
hotels, restaurants, bars, and cool spots in
Germany's creative metropolis
2 in 1: Cool Cities Berlin is an extraordinary
illustrated book combining city guide and
portraits of the urban scene
Berliners offer an insider's perspective on
themselves and their city
[G] teNeues | Hardback | Eng./ Germ. ed. |
320 x 250 mm | 220 p | 250 col.ill. | ISBN:
9783832798222 | € 49,90 [BE] / € 49,90 [NL]
/ € 49,90 [INT]| May 2014
[G] teNeues | Hardback | Eng./ Germ. ed. |
320 x 250 mm | 220 p | 250 col.ill. | ISBN:
9783832798215 | € 49,90 [BE] / € 49,90 [NL]
/ € 49,90 [INT]| May 2014
Cool Escapes Ibiza
Cool Escapes Mallorca
Discover Ibiza's most beautiful elements,
from trendy spots to hidden treasures
Portraits of fascinating inhabitants bring this
island community to life
Chefs and bartenders reveal their best
recipes
Impressive photographs perfectly convey
Mallorca's Mediterranean charm
Features many highlights off the beaten
track
Fans of popular Spanish cuisine will
appreciate this volume's specially selected
recipes
[G] teNeues | Hardback | Eng./ Germ. ed. |
320 x 250 mm | 220 p | 250 col.ill. | ISBN:
9783832797782 | € 49,90 [BE] / € 49,90 [NL]
/ € 49,90 [INT]| April 2014
[G] teNeues | Hardback | Eng./ Germ. ed. |
320 x 250 mm | 220 p | 250 col.ill. | ISBN:
9783832797775 | € 49,90 [BE] / € 49,90 [NL]
/ € 49,90 [INT]| Feb. 2014
Cool Escapes
Honeymoon Resorts
/XQHGH0LHO5HVRUWV
A honeymoon is one of life's most memorable
events and just as integral a part of the
wedding as the cake and bridal bouquet. This
unique volume showcases heavenly
honeymoon resorts from all around the globe,
from a Seychelles beach villa with an infinity
pool and an urban boutique hotel to a stately
English castle. Each offers special packages for
both the newly love-struck and those looking
to savor their longlasting marital bliss.
[G] teNeues | Hardback | Eng./ Fr./ Germ. ed.
| 320 x 250 mm | 220 p | 250 col.ill. |
ISBN: 9783832798192 (Eng. cover) |
ISBN: 9783832798376 (Fr) cover)
| € 49,90 [BE] / € 49,90 [NL] / € 49,90 [INT]|
March 2014
50
INTERIOR DESIGN 1 TRAVEL
Living in Style New York
Long a magnet for leaders in fashion, art,
design, and commerce, this metropolis is home
to one of the most influential assortments of
tastemakers anywhere. It's no wonder that
New York's top interiors would be as dynamic
and varied as its inhabitants. Browsing through
the pages of this stunning volume, we get a
chance to glimpse the luxurious and
imaginative rooms normally hidden from public
view-or only ever seen by the privileged
few-amid both urban and country landscapes.
[G] teNeues | Hardback | Eng./ Fr./ Germ. ed.
| 320 x 260 mm | 220 p | 250 col.ill. | ISBN:
9783832798048 | € 49,90 [BE] / € 49,90 [NL]
/ € 49,90 [INT]| March 2014
Living in Style Mexico City
Living in Style Ibiza
For many years now, Mexico City has been
informally dubbed "the capital of Latin
America." Home to countless museums and
spectacular public buildings, its most
distinguished private residences are also
among the most glamorous and original
anywhere in the world. This exceptional
compendium showcases some of the city's
most prominent individuals and creative
talents-allowing them to take us on an intimate
tour of the spaces they have created as their
personal sanctuaries and sources of inspiration.
Ibiza is an island of contrasts. It is both a
haven for hippies as well as for the
international rich and famous, a destination for
dropouts as well as for party-goers. They all
love the island's charms, its beautiful beaches,
and scenery, where they can savor the salty air
as it drifts up from the salt fields and enjoy
parties with the most renowned DJs in the
world. From centuries-old fincas in the typical
Spanish style to uniquely modern houses-the
islanders maintain an exclusive and
cosmopolitan style.
[G] teNeues | Hardback | Eng./ Germ./
Spanish | 320 x 250 mm | 220 p | 250 col.ill. |
ISBN: 9783832798062 | € 49,90 [BE] / €
49,90 [NL] / € 49,90 [INT]| March 2014
[G] teNeues | Hardback | Eng./ Germ./
Spanish | 320 x 250 mm | 220 p | 250 col.ill. |
ISBN: 9783832798055 | € 49,90 [BE] / €
49,90 [NL] / € 49,90 [INT]| May 2014
51
ARCHITECTURE
New Brazilian House
Nordic Light
Vertical Living
Dominic Bradbury. Photographs by Richard
Powers
Modern Scandinavian Architecture
Interior Experiences by Yoo
This book celebrates established icons, newly
discovered gems and contemporary
masterworks that represent the highest
expression of Scandinavian design and
response to their environment. Fifty projects
are featured in detail, ordered according to the
way in which different light conditions have
imparted particular qualities on the buildings.
Dominic Bradbury and John Hitchcox
From São Paulo to Rio, to the coastal towns of
Paraty and Ilhabela, the locations in this lively
book cover a diverse range of projects, from
stunning city homes to country retreats.
Featuring iconic projects by Marcos Acayaba
and Pritzker-prize-winning architect Paulo
Mendes da Rocha, together with homes by
designers such as Fernanda Marques,
Guilherme Torres and André Piva, New
Brazilian House is a wonderful reflection of the
vitality and verve of Brazils architecture and
design today.
[UK] T & H | Hardback | Eng. ed. | 260 x 235
mm | 256 p | 303 col.ill. | ISBN:
9780500517338 | € 36,00 [BE] / € 36,00 [NL]
/ € 36,00 [INT]| April 2014
[UK] T & H | Hardback | Eng. ed. | x mm |
256 p | 513 col. & bw ill. | ISBN:
9780500291375 | € 32,50 [BE] / € 32,50 [NL]
/ € 32,50 [INT]| Feb. 2014
Here is a celebration of the groundbreaking
designers and innovative spaces that are
reinventing the high-rise urban apartment
complex as a desirable, luxurious and
ecologically sustainable lifestyle choice for the
21st century. Vertical Living offers an enticing
journey through this innovative design
approach, from gloriously welcoming lobbies to
communal relaxation zones to fresh, open plan
personal living spaces and spa style
bathrooms.
New in paperback
[UK] T & H | Hardback | Eng. ed. | 250 x 200
mm | 224 p | 140 col.ill. | ISBN:
9780500517352 | € 28,50 [BE] / € 28,50 [NL]
/ € 28,50 [INT]| Feb. 2014
The Way We Live: In the Country
The Way We Live: With Colour
Extreme Minimalism Architecture
(Compact edition)
(Compact Edition)
Chris Van Uffelen
Stafford Cliff. Photographs by Gilles de
Chabaneix
Stafford Cliff. Photographs by Gilles de
Chabaneix
This is a comprehensive sourcebook of
decorative ideas and much more for anyone
who dreams of living in the country, or is lucky
enough to live there already.
stunning photographs from across the world
capture the distinctive architecture, decorative
schemes, landscapes and rustic details that
make country living so desirable. Traditional
and contemporary elements are treated with
the same sympathetic eye: an airy, minimalist
room looks out on an ancient piazza; herbs and
antique tools hang from wooden bea
This popular book in the bestselling Way We
Live series a visually thrilling exploration of the
way people around the world live with colour is
now available in an elegant compact edition.
Divided into five main sections, the book
showcases Gilles de Chabaneixs eye for the
telling use of colour in interiors in a multitude
of places and cultures, from startling coastal
blues to the subtle monochromes of minimalist
urban styles, from the sumptuous and grand
reds and purples of palatial dwellings to the
sunlit
Representing various types of structures, the
chosen examples are mostly based on the
concept of a simple comprehensive overall
shape, focus on a few main materials as means
of expression, and are comparatively simple to
implement. Despite, or perhaps due to, the
consistently applied limitations, the results are
extremely remarkable.
[UK] T & H | Paperback | Eng. ed. | 214 x
200 mm | 256 p | 300 col. & bw ill. | ISBN:
9780500291368 | € 18,50 [BE] / € 18,50 [NL]
/ € 18,50 [INT]| April 2014
[UK] T & H | Paperback | Eng. ed. | 214 x
200 mm | 256 p | 300 col. & bw ill. | ISBN:
9780500291351 | € 18,50 [BE] / € 18,50 [NL]
/ € 18,50 [INT]| April 2014
52
[G] Braun | Hardback | Eng. ed. | 280 x 240
mm | 240 p | 400 col.ill. | ISBN:
9783037681640 | € 49,95 [BE] / € 49,95 [NL]
/ € 49,95 [INT]| March 2014
ARCHITECTURE
Temporary Architecture
A Home in Provence
Plain Simple Useful
Lisa Baker
Interiors, Gardens, Inspiration
The Essence of Conran Style
Temporary buildings can be both interim
solutions that no longer serve a purpose at a
specific point in time, or projects constructed
for special occasions. In all instances, they
take possession of a location for a certain time,
giving it a new meaning and quality. Architects
who create temporary architecture have to
plan the disappearance of their work from the
outset.
Noëlle Duck
Provençal houses are true homes. Warm
shades of ochre glow from the walls and roofs,
weathered floors shine, and reflections glance
off glazed ceramics and strike printed cotton
tablecloths. This volume showcases some of
the most beautiful houses in Provence,
including French designer Edith Mézards home
and British designer Terence Conrans former
French residence. Images of gold-hued walls,
iron balustrades, leafy terraces, and painted
shutters inspire in the readers mind.
Plain Simple Useful is organized according to
the main activities that take place at home.
Inspirational interiors, many of which are
Conran's own, and a number of projects
designed by him exclusively for this book,
provide all the guidance you need to
tailor-make your own storage. The book also
features iconic examples of classic designs that
will enhance any home, as well as a peek
behind the closed doors of those well-ordered
cupboards, larders and other stowing spaces
that contribute so much .
[F] Flammarion (Eng) | Hardback | Eng. ed. |
240 x 190 mm | 216 p | 150 col. & bw ill. |
ISBN: 9782080201768 | € 32,50 [BE] / €
32,50 [NL] / € 32,50 [INT]| May 2014
[UK] Conran | Hardback | Eng. ed. | 253 x
201 mm | 224 p | 225 col.ill. | ISBN:
9781840916553 | € 36,95 [BE] / € 36,95 [NL]
/ € 36,95 [INT]| May 2014
[G] Braun | Hardback | Eng. ed. | 280 x 240
mm | 240 p | 400 col.ill. | ISBN:
9783037681695 | € 49,95 [BE] / € 49,95 [NL]
/ € 49,95 [INT]| May 2014
Compact Edition
Manhattan Classic
Modern Originals
The Urban House
New York's Finest Prewar Apartments
Geoffrey Lynch
At Home with Midcentury European
Designers
Townhouses, Apartments, Lofts and other
spaces for city living
The Dakota. The Apthorp. The San Remo. The
names of these legendary New York apartment
buildings evoke images of marble-lined lobbies,
uniformed doormen and sunlit penthouses with
sweeping Central Park views. Built from the
1880s through 1930s, classic pre-war
apartments were designed to lure townhouse
dwellers reluctant to share a roof with other
families. Billed as private mansions in the sky,
they promised a charmed Manhattan lifestyle
of elegance and luxury.
This gorgeously photographed volume features
the under-published private spaces of both the
icons and unknown vanguards of European
mid-century architecture and design. In
keeping with the functional beauty of
mid-century design, Handcrafted Modern:
Europe presents the innovative homes by some
of the most compelling and influential
European mid-century designers, including Le
Corbusier, Robin and Lucienne Day, and Gae
Aulenti, to name a few.
Ron Broadhurst. Forword by Richard Meier
[US] Princeton | Hardback | Eng. ed. | 305 x
229 mm | 224 p | 200 col.ill. | 175 bw ill. |
ISBN: 9781616891671 | € 41,50 [BE] / €
41,50 [NL] / € 41,50 [INT] | April 2014
[US] Rizzoli | Hardback | Eng. ed. | 254 x 203
mm | 224 p | 200 col.ill. | ISBN:
9780847842230 | € 49,95 [BE] / € 49,95 [NL]
/ € 49,95 [INT]| April 2014
53
An authoritative volume on the most
innovative new residential design in cities
around the globe. With the newest work from
such design luminaries as Andrée Putman,
Annabelle Selldorf, and Richard Meier, as well
as emergent talents like Barbara Bestor and
Messana O'Rorke, The Urban House is a
uniquely coherent volume on the best in new
residential design.
[US] Rizzoli | Paperback | Eng. ed. | 228 x
228 mm | 300 p | 250 col.ill. | ISBN:
9780847839551 | € 46,50 [BE] / € 46,50 [NL]
/ € 46,50 [INT]| Jan. 2014
FASHION
The Fashion Resource Book: Men
Robert Leach
This companion to the successful The Fashion
Resource Book shows student and professional
designers how to use visual research to
develop a personal aesthetic as a fashion
designer in a global industry.
The concept-led work of such contemporary
designers as Christopher Shannon and Walter
Van Beirendonck is also explored.
1000 Dresses
The Fashion Design Resource
Tracy Fitzgerald and Alison Taylor
This book is a comprehensive library of dress
styles to be used as a reference for the fashion
designer, fashion student and anyone
interested in the fashion industry. The book is
a springboard for ideas.
Creating an overview of how the dress evolved
and its impact on the fashion industry, the
authors pay homage to the experimental, the
beautiful, and the innovative, showing how a
dress can encapsulate a designers vision and
can often act as the key piece within a
collection.
[UK] T & H | Paperback | Eng. ed. | 230 x
177 mm | 208 p | ISBN: 9780500291320 | €
28,50 [BE] / € 28,50 [NL] / € 28,50
[INT]| March 2014
[UK] T & H | Paperback | Eng. ed. | 254 x 215
mm | 288 p | throughout col.ill. | ISBN:
9780500291443 | € 24,95 [BE] / € 24,95 [NL]
/ € 24,95 [INT]| March 2014
The Fashion Swatch Book
Hippie Chic
Fabric for Fashion
Marnie Fogg
Lauren D. Whitley
The Complete Guide
Featuring fabric designs by more than one
hundred of the worlds top fashion designers
and brands, and over 1,100 colour and black
and white images, this is the most
comprehensive sourcebook of fashion fabrics
ever produced.
These factory photoshoots (digital and screen
printing, discharge printing, knitwear, hand
embroidery, hand weaving, jacquard weaving,
lace) offer an invaluable insight into the world
of fabric manufacturing today.
The 1960s saw a revolution in fashion that was
born, like most things new and hip in that era,
of youth rebellion in the streets. For the first
time, high-end designers didn't dictate the
trends. Instead, the latest looks trickled up into
the top fashion houses, Halston and Yves Saint
Laurent among them, by way of bohemian
boutiques, avant-garde labels, and musicians
like the Beatles, Janis Joplin and Jimi Hendrix.
This book provides a fascinating introduction to
the widespread hippie chic trend.
Fabric For Fashion: The Complete Guide is the
only book specifically for fashion designers to
explain the behaviour and properties of
different fabrics. Fashion design is largely
determined by how the fabrics work, move,
feel and look. The most successful fashion
designers are those who understand their
materials, who match design skill with
technical knowledge.
[UK] T & H | Paperback | Eng. ed. | 264 x
206 mm | 448 p | 1115 col. & bw ill. | ISBN:
9780500291337 | € 43,50 [BE] / € 43,50 [NL]
/ € 43,50 [INT]| April 2014
[UK] T & H, Distributed | Hardback | Eng. ed.
| 267 x 203 mm | 152 p | 145 col.ill. | ISBN:
9780878467952 | € 36,00 [BE] / € 36,00 [NL]
/ € 36,00 [INT]| Feb. 2014
54
[UK] Laurence King | Paperback | Eng. ed. |
280 x 216 mm | 272 p | 515 col. & bw ill. |
ISBN: 9781780673349 | € 28,50 [BE] / €
28,50 [NL] / € 28,50 [INT]| Feb. 2014
FASHION
Fashion Knitwear
1920s Style
1940s Fashion
How to Get the Look of the Decade
The Definitive Sourcebook
The Roaring Twenties was a time of
emancipation for women and clothing fashions
developed with women's changing roles in
society. For the first time, the corset was
discarded, women's legs were shown, bare
arms were exposed and the hair was cut into
an easy-to-manage bob. 1920s Style
documents this amazing turning point in
fashion with historical information on the
designers and developments that shaped the
decade's design style.
"1940s Fashion: the Definitive Sourcebook"
covers every aspect of female fashions from
the period, from lacy evening gowns, tailored
skirt-suits and luxurious fur jackets to
figure-sculpting undergarments, satin negligees
and glamorous swimwear. The introduction
outlines the different themes of the period and
each chapter is given an introduction.
Biographies of major designers of the time are
included, for an in-depth look at who shaped
the 1940s fashion world.
[UK] Laurence King | | Eng. ed. |245 x 210 mm
| p | ISBN: 9781780673431 |
€ 36,00 [BE] / € 36,00 [NL] / € 36,00 [INT]|
April 2014
[UK] Carlton | Hardback | Eng. ed. | 237 x
185 mm | 144 p | ISBN: 9781780974446 | €
27,50 [BE] / € 27,50 [NL] / € 27,50
[INT]| Oct. 2013
[UK] Carlton | Paperback | Eng. ed. | 244 x
194 mm | 512 p | ISBN: 9781847960467 | €
43,50 [BE] / € 43,50 [NL] / € 43,50
[INT]| May 2013
Childhood Chic
Berlin Fashion
Demin Style
Children's Fashions from Vintage to
Modern Day
A Style Guide
Horst A. Friederichs
It's been more than two decades since the wall
dividing Berlin's east and west sides came
down. Since then the city has evolved into a
Mecca for the international fashion crowd,
attracted by the city's artistic history, its
newfound exuberance and reasonable cost of
living. Written by a style insider, this book
explores every aspect of the city's love affair
with clothing. In an engaging series of brightly
illustrated chapters it explains what makes
Berlin's fashion scene unique.
This book takes in all aspects of the thriving
denim culture, whose followers can be
obsessive about how the denim is woven, the
old shuttle looms that weave it, the people who
weave it, and the skills and techniques they
have and use. Pages of gorgeous photographs
of denim wear will inspire today's style
conscious and trendspotters alike.
Knitwear is one of the most exciting areas in
fashion today, where craft and digital
processes collide to create desirable,
innovative clothing. Fashion Knitwear
showcases 40 designers around the world,
including Missoni, Sibling and Sonia Rykiel,
who use hand and machine knitting, crochet
and macramé, as well as knit fabrics such as
jersey, to produce fashion garments. Each
profile delves into the designers practice,
inspiration and career path and includes
inspiring images of their work.
Reflecting today's resurgence of interest in
childrenswear, Childhood Chic is an insightful
and beautifully illustrated guide to over 100
years of design. Chapters cover traditional
styles and includes an A-Z of designers and
couturiers that have influenced children's
fashion. A final chapter discusses the current
fascination with mini couture and the explosion
of labels now featuring children's lines, the rise
of tot couture and stylish celebrity child role
models.
[UK] Carlton | Hardback | Eng. ed. | 276 x
216 mm | 224 p | throughout col. & bw ill. |
ISBN: 9781780975085 | € 36,00 [BE] / €
36,00 [NL] / € 36,00 [INT]| June 2014
[UK] Prestel | Paperback | Eng. ed. | 240 x
165 mm | 192 p | 130 col.ill. | ISBN:
9783791348858 | € 23,50 [BE] / € 23,50 [NL]
/ € 23,50 [INT]| March 2014
55
[UK] Prestel | Flexi (Pb luxe) | Eng. ed. | 270
x 193 mm | 176 p | 160 col.ill. | ISBN:
9783791349565 | € 27,95 [BE] / € 27,95 [NL]
/ € 27,95 [INT]| April 2014
FASHION
New York Bike Style
Berlin Street Style
Fashionable Selby
Sam Polcer, with a foreword by Casey Neistat
A Guide to Urban Chic
By Todd Selby, foreword by Simon Doonan
America may be a nation obsessed with
automobiles, but today the bicycle is giving the
car a run for its money. The book features
close-up shots of gear: wheels, seats,
handlebars, baskets, pedals, and panniers and
a startlingly stylish array of bike fashion.
Whether they're pedaling to work or play,
racing with a club, or out for a lazy ride, New
York Bike Style pays photographic tribute a city
in love with biking in all its forms.
Angelika Taschen with Alexa von Heyden.
Photographs by Sandra Semburg
Todd Selby returns with a behind-the-scenes
look at the people who make the fashion world
go round.
This third installment in the Selby series
focuses on the world of fashion, featuring
photographs and illustrations of clothing
designers, stylists, haberdashers, editors,
models, shoemakers, photographers and more.
[UK] Prestel | Flexi (Pb luxe) | Eng. ed. | 240
x 193 mm | 224 p | 200 col.ill. | ISBN:
9783791348964 | € 27,95 [BE] / € 27,95 [NL]
/ € 27,95 [INT]| March 2014
In Berlin Street Style, noted design expert
Angelika Taschen explains the unique style of
this hip city. Where Parisians may covet a
Hermes bag, a Chanel little black dress or chic
ballet flats, Berliners don military parkas,
sneakers and jeans. The look is casual, edgy,
accessible, eclectic and a little rock and roll.
The book shows the popular "anti-chic" look
seen throughout the city, offering advice on
how to achieve the appealingly disheveled
Berlin look.
[US] Abrams | Hardback | Eng. ed. | 279 x
203 mm | 348 p | ISBN: 9781419708619 |
€ 32,00 [BE] / € 32,00 [NL] / € 32,00
[INT]| Jan. 2014
[US] Abrams | Paperback | Eng. ed. | 241 x
159 mm | 240 p | 200 col.ill. | ISBN:
9781419712579 | € 22,50 [BE] / € 22,50 [NL]
/ € 22,50 [INT]| April 2014
Incl. 12 silhouetten - incl. 2 patroonvellen en
3 labels
50 Ways to Wear a Scarf
By Lauren Friedman
From the Audrey to the Paris, the Top Down, or
the Easy Breezy, there are 50 scarf styles in
this book for any occasion or mood. Jaunty
illustrations break down each step so stylistas
can wrap, loop and get out the door looking
perfectly polished. Teens, young professionals
and mums alike will love playing around with
the looks, including unexpected belts, sarongs
and topknots. Vibrantly illustrated and packaged
as a compact hardcover.
[US] Chronicle Books | Hardback | Eng. ed. |
152 x 203 mm | 128 p | 150 col.ill. |
ISBN: 9781452125978 |
€ 13,95 [BE] / € 13,95 [NL] / € 13,95 [INT]|
March 2014
De geknipte outfit
met 1 meter stof
A collection by Marijke Sileghem
Wat kan je doen met 1 meter stof? Dat is het
uitgangspunt van het boek van Marijke
Sileghem. Zij ging de uitdaging aan om telkens
met slechts één metertje stof een mooi,
hedendaags, boeiend en draagbaar kledingstu
te maken. Handig en compact werken, snel k
klaar, een degelijk resultaat met optimaal
stofverbruik... en een indrukwekkende variatie
aan combinatiemogelijkheden!
In het 1ste deel worden stap voor stap een
16-tal kledingstukken gemaakt, in het 2de
deel worden die tot leuke outfits
gecombineerd.
[BE] Stichting Kunstboek | Paperback | NL ed.
| 240 x 190 mm | 128 p | 100 col.ill. | ISBN:
9789058564733 | € 24,95 [BE] / € 24,95 [NL]
/ € 24,95 [INT]| Dec. 2013
56
LIFE STYLE & LUXURY
The Classic Cars Book
Photographs by René Staud
New additions to the automotive market are judged primarily
by efficiency or fuel consumption. Things are quite different
for historical cars. Major car shows, from Pebble Beach to
Villa d'Este, feature classic cars, which, although they may
not achieve top marks in the wind tunnel, have a timeless
elegance that makes the hearts of all aficionados skip a beat.
The photographer Ansel Adams, who was an honorary
judge at Pebble Beach, once defined them as follows: "The type
of vehicle I would like to be buried in." From the Jaguar XK 140
to the Porsche 550 Spyder, René Staud has shot automotive
classics in settings ranging from the subtle to the spectacular.
As co-organizer and head of the Car Selection Committee for
Schloss Bensberg Classics, Jürgen Lewandowski provides
authoritative texts. The Classic Cars Book conveys a real passion
for these spectacular vehicles, appealing to existing fans and those
yet to fall under their spell.
[G] teNeues | Hardback | Eng/ Fr/ G/ Russ/
Chin. ed | 370 x 290 mm | 304 p | 200 col.ill. |
ISBN: 9783832798284 | € 98,00 [BE] / €
98,00 [NL] / € 98,00 [INT]| March 2014
The Aston Martin Book
Photographs by René Staud
For the fiftieth anniversary of James Bond in
2012, two icons came together who jointly
epitomize the very essence of British coolness.
In Skyfall, Daniel Craig, as agent 007, powered
across the screen in an Aston Martin DB5, the
very same thrilling six-cylinder that Sean
Connery drove in Goldfinger. Meanwhile, Aston
Martin has celebrated a milestone birthday.
[G] teNeues | Hardback | Eng/ Fr/ G/ Russ/
Chin. ed | 370 x 290 mm | 304 p | 200 col.ill. |
ISBN: 9783832798185 | € 128,00 [BE] / €
128,00 [NL] / € 128,00 [INT]| March 2014
Vespa
Velerio Boni, Azzurra Della Penna
The book includes a gatefold listing the Vespa
models from 1943 to today along with images
of Vespa's throughout the decades, including
the most iconic designs as well as today's
luxury editions. In colorful photographs and
text this volume also traces the succession of
technological and stylistic improvements that
have helped maintain Vespa's status as one of
the world's iconic scooter brands.
[UK] Prestel | Hardback | Eng. ed. | 280 x 230
mm | 248 p | 200 col.ill. | ISBN:
9783791348919 | € 41,50 [BE] / € 41,50 [NL]
/ € 41,50 [INT]| March 2014
57
SPORTS
Golf ter Hille
The Bike Deconstructed
Van abdijhoeve tot eco-golf
A Grand Tour of the Modern Bicycle
1001 Bikes: To Dream of Riding
Before You Die
Het publieksboek Golf ter Hille vertelt in
diverse hoofdstukken het boeiende verhaal van
de historische ontwikkeling van het landschap
en de domeinhoeve Hof ter Hille en de
bewoning vanaf de volle middeleeuwen tot en
met de aanleg op locatie van Golf ter Hille in
Oostduinkerke-Koksijde. Een 12-tal auteurs
verleenden hun medewerking aan dit rijkelijk
geïllustreerde boek
Richard Hallett
Daniel Benson
[BE] Stichting Kunstboek | Hardback | NL ed.
| 300 x 240 mm | 192 p | ISBN:
9789058564887 | € 35,00 [BE] / € 35,00 [NL]
/ € 35,00 [INT]| June 2014
Brazil
The Beautiful Game
Having photographed football in Brazil for two
decades, no one understands the country's
obsession with the sport better than
Christopher Pillitz. From Brazil's sun kissed
beaches to its spotlessly clean favelas, Pillitz
reveals the sport as Brazil's religion. His bold
and brightly coloured photographs show
players of every age and walk of life.
[UK] Prestel | Hardback | Eng. ed. | 280 x 240
mm | 200 p | 175 col.ill. | ISBN:
9783791348940 | € 34,50 [BE] / € 34,50 [NL]
/ € 34,50 [INT]| March 2014
Brazil Fifa World Cup : 12/06-13-07 2014
Do you know the difference between a head
tube and a headset? Can you tell whether a
frame is made from steel or carbon fibre? Do
you know how a derailleur works and why it
revolutionized bike design? If not, this is the
perfect guide for you. The Bike Deconstructed
celebrates bicycle design by looking at its
individual components, large and small. Their
historical roots are explored, key features
identified and principal uses (and sometimes
misuses) revealed.
[UK] M. Beazley | Hardback | Eng. ed. | 255 x
200 mm | 192 p | 200 col.ill. | ISBN:
9781845338831 | € 29,50 [BE] / € 29,50 [NL]
/ € 29,50 [INT]| March 2014
Distant Shores: Surfing The Ends
Of The Earth
by Chris Burkard
Edited by Steve Crist
Chris Burkard's photographs are punctuated by
energized landscapes and moments of bliss, by
adventure seeking and the lifestyle that it
encompasses, and by movement and intuitive
light-working capabilities. With the ocean as
his main muse, Burkard has consistently
captured his subject in timeless and expansive
photographic impressions, utilizing the tool of
surfing to approach the ocean's intricate
personality and then extending out to include
the human personalities that draw meaning
from this same source.
[US] Ammo | Hardback | Eng. ed. | 393 x 292
mm | 160 p | 100 col.ill. | ISBN:
9781623260170 | € 39,95 [BE] / € 39,95 [NL]
/ € 37,69 [INT]| Jan. 2014
58
Never before have so many bicycles been
profiled within one beautifully illustrated
volume. 1001 Bikes to Dream of Riding Before
You Die explores in detail the greatest bikes of
all time and from across the globe: from the
early historic velocipedes of the 1890s to the
arrival of today's standard upright bikes that
dominate the marketplace.
[UK] Cassell | Paperback with flaps | Eng. ed.
| 210 x 160 mm | 960 p | 800 col.ill. | ISBN:
9781844037636 | € 28,95 [BE] / € 28,95 [NL]
/ € 28,95 [INT]| June 2014
1000 Football Shirts
The most comprehensive collection ever of
iconic soccer uniforms from around the world,
featuring more than 1,000 illustrations
representing 100 countries and 500 major
teams. This massively illustrated and
comprehensive volume presents and explains
the team shirts worn by the world's leading
soccer clubs and national teams from one
hundred countries over the past one hundred
years. In addition to detailing the colorful
histories behind each shirt, the book also
highlights the personalities and players.
[US] Rizzoli | | Eng. ed. | x mm | p |
ISBN: 9780789327307 | € 31,00 [BE] / €
31,00 [NL] / € 31,00 [INT]| April 2014
MUSIC
Bruce Springsteen
The Killers
Bruno Mars
Album by Album
Days & Ages
The Unauthorised Biography
Ryan White
Mark Beaumont
Emily Herbert
A definitive retrospective and chronology of
each of Bruce Springsteen's 17 studio albums,
fully illustrated with many previously
unpublished photographs, this book is
published to coincide with the 30th anniversary
of Springsteen's most successful album, 1984's
multi-million selling Born in the U.S.A.
The ultimate story of The Killers' rise from Las
Vegas croupiers to million selling global
superstars headlining festivals throughout the
world. Featuring interview transcripts with the
band as well as new interviews with them and
those around them right up to their new album
Battle Born.
[UK] Carlton | Hardback | Eng. ed. | 300 x
230 mm | 256 p | 250 col. & bw ill. | ISBN:
9871780975115 | € 43,95 [BE] / € 43,95 [NL]
/ € 43,95 [INT]| May 2014
[UK] Omnibus +firm+ | Paperback | Eng. ed.
| 234 x 156 mm | 256 p | some col.ill. | ISBN:
9781783050451 | € 21,95 [BE] / € 21,95 [NL]
/ € 21,95 [INT]| June 2014
Peter Gene Hernandez (born October 8, 1985),
known by his stage name Bruno Mars, is an
American singer-songwriter and record
producer. Born and raised in Honolulu, Hawaii,
by a family of musicians, Mars began making
music at a young age and performed in various
musical venues in his hometown throughout his
childhood. Throughout a singing career
spanning 3 years, he has sold 10 million
albums and 58 million singles worldwide.
Metallica Nothing Else Matters
Tom Petty
Lou Reed: Magic & Loss
The Graphic Novel
Rock'n Roll Guardian
Peter Doggett
Jim McCarthy (Author), Brian Williamson
(Illustrator)
Tom Petty is an American singer-songwriter
and multi-instrumentalist. He is the frontman
of Tom Petty and the Heartbreakers and was a
founding member of the late 1980s supergroup
Traveling Wilburys. He has recorded a number
of hit singles with the Heartbreakers and as a
solo artist. Throughout his career, Petty and his
collaborators have sold 60 million albums. In
2002, he was inducted into the Rock and Roll
Hall of Fame. In 2012 and 2013 he embarked
on his first North American and European tour
in 20 years
Lou Reed consistently challenged the
conventions of rock music. He created the
Velvet Undergound, the most influential cult
band of the sixties, and inspired a generation
of punk rebels.
From the creators of Gabba Gabba Hey! The
Graphic Story of The Ramones comes an
explosive new graphic novel about the world's
greatest heavy metal band, Metallica. By far
the most successful of thrash metal's original
big four, incredibly Metallica have now been
performing for well over 20 years.
[UK] Omnibus +firm+ | Paperback | Eng. ed.
| 244 x 166 mm | 160 p | ISBN:
9781783051861 | € 21,95 [BE] / € 21,95 [NL]
/ € 21,95 [INT]| April 2014
[UK] Omnibus +firm+ | Paperback | Eng. ed.
| 232 x 156 mm | 384 p | ISBN: 9781780387420
| € 28,95 [BE] / € 28,95 [NL] / € 28,95 [INT]|
Feb. 2014
59
[UK] Omnibus +firm+ | Paperback | Eng. ed.
| 234 x 156 mm | 224 p | some col.ill. | ISBN:
9781783053551 | € 28,95 [BE] / € 28,95 [NL]
/ € 28,95 [INT]| March 2014
His art took in drug addiction,
sado-masochism, death-wishes, degredation
and despair.
Latterly he re-invented himself as a poet and
thinker, a deeply serious man whose past was
forgiven amidst the accolades that age brought
him.
[UK] Omnibus +firm+ | Paperback | Eng. ed.
| 234 x 156 mm | 208 p | various bw ill. |
ISBN: 9781783054947 | € 21,95 [BE] / €
21,95 [NL] / € 21,95 [INT]| Feb. 2014
MUSIC & CINEMA
Bach
Leonard Cohen
New Illustrated Lives of Great Composers
(incl CD)
Almost Young
Tim Dowley
A tribute to Canadian-born poet and
singer-songwriter Leonard Cohen who will be
80 in September 2014: Pictures by famous and
unfamous photographers portray Cohen's
career of 50 years, from his early years on the
Greek island of Hydra to his 2008 induction
into the Rock and Roll Hall of Fame and his
most recent concerts.
A new and fascinating biography of the most
outstanding composer in musical history,
covering Bach's earliest musical efforts in
Eisenach, his cultural inheritance, his series of
posts as organist or musician, and his stormy
career in Leipzig.It also traces the significant
stages of development in his family and his
music. Reproductions of engravings and
portraits of the time help to recreate the era in
which Bach flourished.
[UK] Omnibus +firm+ | Paperback | Eng. ed.
| 248 x 170 mm | 144 p | some bw ill. | ISBN:
9781780384474 | € 19,50 [BE] / € 19,50
[NL] / € 19,50 [INT]| March 2014
75000 Films
Leonard Cohen
[G] Schirmer/ Mosel | Hardback | Eng. ed. |
240 x 215 mm | 144 p | 80 col.ill. | ISBN:
9783829606646 | € 27,95 [BE] / € 27,95 [NL]
/ € 27,95 [INT]| April 2014
What lies behind the screen of a film archive?
Very few had the chance to discover. 75000
FILMS is a very personal voyage into this
unknown territory, guided by the photos of
Xavier Harcq, Jimmy Kets and
Marie-Françoise Plissart and the texts of
David Bordwell, Eric de Kuyper and
Dominique Païni. Six different points of view
into a film archive: the activities, the role, the
spaces, the people, the gestures of those who
make sure that films will live forever.
Cinémathèque royale de Belgique
/Koninklijk Belgisch Filmarchief.
[BE] Yellow Now | Paperback | Eng./ Fr./ NL
ed. | 235 x 165 mm | 144 p | 90 col.ill. |
ISBN: 9782873403485 | € 20,00 [BE] / €
20,00 [NL] / € 18,87 [INT]| Dec. 2013
Grace Kelly
Hollywood contacts
Film Stills
Movie Stars Behind the Scenes
The Art of DreamWorks
Animation
Daniel Dreier
Karina Longworth
Celebrating 20 Years of Art
Grace Kelly gave up her acting career for the
real-life role of Princess Grace of Monaco. In
just four years she had made eleven movies,
three of them with Alfred Hitchcock. Grace
Kelly Film Stills is a celebration of her immortal
beauty and an oblique tribute to "Hitch".
Photographers contact sheets are the
permanent record of every shot that they took
- and through Hollywoods golden age, there
was o!en a photographer on set, capturing the
scene as actors and directors collaborated to
produce classic movies.
This book collects the contact sheets from
classic movies like King Kong (1933), Some
Like it Hot (1959), Taxi Driver (1976), Pulp
Fiction (1994), and many more. Capturing
legends such as Woody Allen, Audrey Hepburn,
Alfred Hitchcock, Marilyn Monroe, and Frank
Sinatra
By Ramin Zahed. Introduct ion by Jeff rey Katz
enberg
[G] Schirmer/ Mosel | Hardback | Eng. ed. |
240 x 215 mm | 144 p | 100 col.ill. | ISBN:
9783829606684 | € 27,95 [BE] / € 27,95 [NL]
/ € 27,95 [INT]| April 2014
[UK] IVY PRESS | Paperback | Eng. ed. | 270
x 220 mm | 208 p | 250 col. & bw ill. | ISBN:
9781781579800 | € 28,95 [BE] / € 28,95 [NL]
/ € 28,95 [INT]| June 2014
60
The Art of DreamWorks Animation marks the
studio's twentieth anniversary and pays
homage to the animators who brought iconic
characters like Shrek and Po to life. Brimming
with concept art, pre-production designs and
character sketches, the book celebrates the art
of animation and offers unprecedented
behind-the-scenes access into the DreamWorks
Animation archive.
[US] Abrams | Hardback | | 305 x 254 mm |
324 p | 400 col.ill. | ISBN: 9781419711664 |
€ 42,00 [BE] / € 42,00 [NL] / € 42,00 [INT]|
April 2014
GIFTS
Keep Britain Tidy
The Book of Hearts
And Other Posters from the Nanny State
Francesca Gavin
'Life is Better on the Land', 'Don't Ask a Man to
Drink and Drive', 'Be Really Cool, Man, Save',
'Clunk Click Every Trip' - with these kinds of
slogan combined with eye-catching graphics
the British government in the postwar era
sought to infl uence everything from the jobs
people did to what they ate and drank, how
they saved their money and behaved on the
road. Over forty of these posters, produced in
the period c. 1945-75, are published here in a
handy detachable format.
This collection of heart imagery highlights how
a universal symbol can be creatively
interpreted and constantly reinvented. It
captures the breadth of art and design imagery
exploring the meaning and representation of
hearts. Although the focus is on the
contemporary, it also touches on the history of
the symbol - from the Sacred Heart cult to the
invention of the Valentine, from heart tattoos
to pictograms. The Book of Hearts is an
exploration of the meaning and representation
of love and emotion.
[UK] T & H | Paperback | Eng. ed. |317 x 240 mm |
94 p | 49 col.ill. | ISBN: 9780500291405 | €
21,50 [BE] / € 21,50 [NL] / € 21,50 [INT]|
April 2014
With 40 detachable posters !
[UK] Laurence King | Paperback | Eng. ed. |
180 x 140 mm | 160 p | throughout col.ill. |
ISBN: 9781780673318 | € 14,50 [BE] / €
14,50 [NL] / € 14,50 [INT]| Jan. 2014
Artists' Colouring Books: 1960s
Secret Garden
20 Postcards
Containing 20 detachable postcards of Johanna
Basford's beautiful drawings from the inky
world of her Secret Garden. Decorate the cards
to bring the flowers and tiny creatures to life,
then share the magic with all your friends. For
artists and gardeners of all ages.
Dandelion Wishes Journal
Delicate watercolour paintings of buds and
blooms adorn the pages of this sweet journal
by Anna Emilia Laitinen.
[US] Chronicle Gifts | Paperback | Eng. ed. |
192 p | throughout col.ill. | ISBN:
9781452128962 | € 10,50 [BE] / € 10,50 [NL]
/ € 10,50 [INT]| April 2014
[UK] Laurence King | Cards | Eng. ed. | 160 x
120 mm | 40 p | ISBN: 9781856699464 | €
12,50 [BE] / € 15,13 [NL] / € 12,50
[INT]| Jan. 2014
61
Pepin Artist's colouring books match the quality
of the finest artists' pads. The are perfectly suited
to practice your colouring skills and create
beautiful pieces at the same time. In order to get
the best results, we recommend you use highquality colouring materials.
Availble titles: Art Nouveau, Turkish Designs,
1960s,Arabian patterns, Still Life Bouquets,
JapaneseDesigns.
[NL] Pepin - Artists' Colouring Books |
Paperback | Eng. ed. | 345 x 250 mm | 16 p |
ISBN: 9789460098031 | € 12,95 [BE] / €
12,95 [NL] / € 12,95 [INT]| April 2014
GIFTS
Fan-fucking-tastic Notecards
'DUWK9DGHU
V/LWWOH3ULQFHVV
Jeffrey Brown
This sweet and funny collection of postcards
is filled with father-and-daughter moments
between Darth Vader, Dark Lord of the Sith
and his rebellious daughter, Princess Leia.
Perfect to send or keep, the cards feature
artwork from Vader's' Little Princess as well
as new illustrations not included in the book.
[US] Chronicle Gifts | Paperback | Eng. ed. |
30 p | throughout col.ill. |
ISBN: 9781452135441 |
€ 10,50 [BE] / € 10,50 [NL] / € 10,50 [INT]|
May 2014
12 Notecards & Envelopes
Darth Vader's Little Princess
Journal
Inspired by the bestselling book Vader's' Little
Princess, this full-colour flexi journal features
Jeffrey Brown's hilarious artwork illustrating
the ups and downs of being a father and a Sith
Lord in a galaxy far, far away.
[US] Chronicle Gifts | Flexi (Pb luxe) | Eng.
ed. | 180 x 127 mm | 192 p | ISBN:
9781452135458 | € 10,50 [BE] / € 10,50 [NL]
/ € 10,50 [INT]| May 2014
Both irreverent and classy, this notecard set
offers a range of exquisitely appropriate
expletives--all rendered in a beautiful,
traditional hand-drawn calligraphy and
foil-stamped on a nice uncoated card stock.
--Fuck Yeah, It's Your Birthday
--Fan-fucking-tastic --You're the Shit --You
Made my Fucking Day
[US] Chronicle Gifts | Boxed | Eng. ed. | x
mm | p | ISBN: 9781452125831 | € 14,50
[BE] / € 14,50 [NL] / € 14,50 [INT]|
March 2014
Box with acetate lid, 12 notecards, 12
envelopes, foil stamping
Memu: 100 Postcards
Letters to My Future Self
F*ck! A Journal for My Twenties
James Jean
Write Now. Read Later. Treasure Forever.
By Emma Koenig
The ultimate trove of James jean's
award-winning work, this deluxe silkscreened,
cloth-covered box contains 100 collectible
postcards of both his iconic paintings and
rarely-seen sketchbook pages.
By Lea Redmond
This journal from Emma Koenig is filled with
prompts inspired by her book, F*CK! I'm in My
Twenties, perfect for twenty-something's who
are just trying to figure things out and need a
place to doodle, vent their feelings, list their
thoughts and maybe gain a little clarity
through writing. It's an active companion--like
having coffee with your funniest friend--and a
place for sharing the most truthful, interesting
and revealing moments of your life. 60 or so
pages throughout will have fill-ins, colour-ins..
[US] Chronicle Gifts | Boxed | Eng. ed. | 159 x
159 mm | 111 p | throughout col.ill. | ISBN:
9781452114385 | € 22,51 [BE] / € 22,51 [NL]
/ € 22,50 [INT]| March 2014
This keepsake book of 12 fold-and-mail style
letters offers a unique way to capture an
elusive moment in time like a dozen diary
entries for the future. The letters offer
thought-provoking prompts ('I promise to
myself...', 'All the things I'd like to try
someday', 'A pep talk for the future me') to
guide self-reflection, and the included stickers
then seal each letter with a classic postal look.
Postdated to be opened in the future, these
letters become a paper time capsules to
treasure forever.
[US] Chronicle Gifts | Hardback | Eng. ed. |
210 x 150 mm | 12 p | ISBN: 9781452125374
| € 34,95 [BE] / € 34,95 [NL] / € 34,95
[INT]| April 2014
12 fold-and-mail envelopes, full-colour sticker
sheet
62
[US] Chronicle Gifts | Paperback | Eng. ed. |
203 x 152 mm | 176 p | 60 col. & bw ill. |
ISBN: 9781452128344 | € 13,20 [BE] / €
13,20 [NL] / € 13,20 [INT]| May 2014
GIFTS
If I Were a Book
Fortune-Telling Book of Colors
By José Jorge Letria Illustrated by André
Letria
K.C. Jones
This sweet celebration of the magic and
wonder of books will delight readers of all
ages. Andre Letria's whimsical illustrations of a
book as a kite, a tent, a ship and more are
paired with Jose Jorge Letria's thoughtful
musings on the joys of reading. In the hands of
this internationally acclaimed father-and-son
duo, a book becomes a mountaintop with a
spectacular vista ("If I were a book, I'd be full
of new horizons"), and an endless staircase of
imagination.
From colour astrology and the meaning behind
colour combinations, to a catalogue of every
colour imaginable and how to use colours to
invite luck, wealth and good fortune into your
life, this little book is the perfect gift for colour
fans.
[US] Chronicle Books | Hardback | Eng. ed. |
121 x 95 mm | 204 p | throughout, col.ill. |
ISBN: 9781452132655 | € 9,95 [BE] / € 9,95
[NL]/ € 9,95 [INT]| April 2014
Padded cover
[US] Chronicle Books | Hardback | Eng. ed. |
203 x 152 mm | 64 p | throughout col.ill. |
ISBN: 9781452121444 | € 12,50 [BE] / €
12,50 [NL]/ € 12,50 [INT]| March 2014
I Could Pee on This: And Other
Poems by Cats
16 Assorted Notecards and Envelopes
Everyone's favourite cat poet's on stationery!
This notecard set will feature some of the star
felines from our New York Times bestseller, I
Could Pee on This, plus all new
material/photos. These will be shorter
poems--to leave room for folks to write their
own message. The cards will have a photo of
the cat and poem title on the outside, and the
poem on the inside, and will cover four
occasions (Thank You, Congratulations, Happy
Birthday and Thinking of You).
[US] Chronicle Books | Boxed | Eng. ed. | x
mm | 16 p | ISBN: 9781452129105 | € 11,95
[BE] / € 11,95 [NL] / € 11,95 [INT]| April
2014
BabyLit® Totes
Sherlock Holmes
for Carrying Your Favorite Books!
Artwork © Alison Oliver
[US] Gibbs Smith | Tote Bag |
ISBN: 9781423635468 |
€ 13,95 [BE] / € 13,95 [NL] / € 13,95 [INT]|
Kids Are Weird
Cats are Weird
And Other Observations from Parenthood
and More Observations
By Jeffrey Brown
Jeffrey Brown
As he's shown in his previous hugely popular
books, Jeffrey Brown has a real gift for finding
humour in quirky yet universal truths. Now the
bestselling author of Darth Vader and Son and
Vader's Little Princess brings his witty comic
observations to terrestrial parenting in this
perceptive book celebrating the more surreal
moments of raising a child. In charming
colourful panels, Brown wryly illustrates his
five-year-old son's take on the world around
him.
Cartoonist Jeffrey Brown's drawings perfectly
capture the humor and quirkiness of cats in all
their strange and charming glory. Following the
success of Cat Getting Out of a Bag, this
all-new collection of color and black-and-white
comic strips loosely follows the adventures of a
pair of cats as they explore the world around
them, indoors and out.
[US] Chronicle Books | Hardback | Eng. ed. |
165 x 165 mm | 108 p | throughout col.ill. |
ISBN: 9781452118703 | € 13,95 [BE] / €
13,95 [NL] / € 13,95 [INT]| April 2014
[US] Chronicle Books | Hardback | Eng. ed. |
165 x 165 mm | 108 p | throughout col. & bw
ill. | ISBN: 9780811874809 | € 12,50 [BE] / €
12,50 [NL] / € 12,50 [INT]| March 2014
-R/P
Reprint
63
Totes I Love Books Read Local, 9781423635451
I Like Big Books, 9781423635444
Books not Bombs Tote, 9781423636694
Books Rock! Tote, 9781423637318
Darcy Heart, 9781423631576
Dracula, 9781423631606
Mad Hatter Mustache Face, 9781423631545
Moby, 9781423633501
Mr. Darcy Tote, 9781423631590
Pride & Prejudice,9 781423635475
Wuthering Heights, 9781423633488,
Sherlock Holmes, 9781423635468
Books, 9781423633471
BabyLit® Totes
Mad Hatter Mustache Face,9781423631545
Cat, 9781423631538
Book Nerd Tote,9781423636670
Books Rock! Tote, 9781423637318
I Like Big Books,9781423635444
Keep Calm, 9781423633426
Read,9781423633464
Read Local, 9781423635451
Read Tote, 9781423637325
GIFTS
Hearts #19
Winter scenes #23
Art Nouveau Textiles #31
Gift wrapping paper book
Gift wrapping paper book
Gift wrapping paper book
[NL] Pepin Press - Gift Wrap +firm only |
Paperback | E/ F/ NL/ G/ SP/ IT/ Jap / Chin ed
| 345 x 250 mm | 16 p | ISBN:
9789460090301 | € 12,95 [BE]/ € 12,95 [INT]|
Jan. 2014
[NL] Pepin Press - Gift Wrap +firm only |
Paperback | E/ F/ NL/ G/ SP/ IT/ Jap / Chin ed
| 345 x 250 mm | 16 p | ISBN: 9789460090356 |
€ 12,95 [BE] / € 12,95 [INT]| Jan. 2014
[NL] Pepin Press - Gift Wrap +firm only |
Paperback | E/ F/ NL/ G/ SP/ IT/ Jap / Chin ed
| 345 x 250 mm | 16 p | ISBN: 9789460090431 |
€ 12,95 [BE] / € 12,95 [INT]| Jan. 2014
1970s patterns # 54
Tattoo
Still Life # 59
Gift wrapping paper book
Gift wrapping paper book
Gift wrapping paper book
[NL] Pepin Press - Gift Wrap +firm only |
Paperback | 345 x 250 mm | 16 p |
E/ F/ NL/ G/ SP/ IT/ Jap / Chin ed |
ISBN: 9789460090660 | € 12,95 [BE] / € 12,95
[INT]| Jan. 2014
[NL] Pepin Press - Gift Wrap +firm only |
Paperback | E/ F/ NL/ G/ SP/ IT/ Jap / Chin ed
| ISBN: 9789460090677 | € 12,95 [BE] /
€ 12,95 [INT]| Jan. 2014
[NL] Pepin Press - Gift Wrap +firm only |
Paperback | 345 x 250 mm | 16 p |
E/ F/ NL/ G/ SP/ IT/ Jap / Chin ed |
ISBN: 9789460090714 | € 12,95 [BE] /
€ 12,95 [INT]| Jan. 2014
PEPIN® gift and creative paper books all contain 4 pages of introduction and 12 large sheets of very high-quality wrapping paper.
They can easily be removed from the books by tearing them along a perforated line
64
GIFTS
Pen Set: Write It Down
When inspiration strikes, be ready to 'Write It
Down with this colourful pen and pencil set.
Perfect for back to school or your own home
office, these eye-catching desk essentials help
you get the job done. The ballpoint pen and
mechanical pencil feature bright artwork
designed to inspire. Pair these with our Write It
Down Basic Journal or Fun Shaped Sticky Notes
for a fun and functional gift.
[US] Galison | Boxed | Eng. ed. |
ISBN: 9780735339699 | € 24,95 [BE] /
€ 24,95 [NL] / € 24,95 [INT]| Jan. 2014
Lenticular Notepads:
Portfolio Notes:
Kandinsky Circles
[US] Galison | MAP |
ISBN: 9780735340299 | € 10,50 [BE] /
€ 10,50 [NL] / € 10,50 [INT]| Jan. 2014
12 tent notecards, 12 envelopes
[US] Galison
NY Times Night & Day
ISBN 9780735340381 | € 7,95
Word of Mouth
ISBN 9780735340251 |€ 7,95
Eye Pad
ISBN 9780735340251 |€ 7,95
Petite Journal Set: Art & Fashion
of George Barbier
This journal set is the definition of chic!
Celebrating the stylish work of French fashion
illustrator George Barbier (1882-1932), each
full-colour cover features one of Barbier's Art
Deco illustrations for publications such as
Journal des Dames et des Modes, with
corresponding patterns on the backs and
spines. These three posh journals are bound
together with natural twine and each contains
96 lined pages.
[US] Galison |
ISBN: 9780735340145 | € 14,50 [BE] / €
14,50 [NL] / € 14,50 [INT]| Jan. 2014
Kim Parker Floral Essential
Everyday Journal:
Artist Kim Parker's exuberant florals on this
vibrant journal will add a splash of colour to
your routine. Featuring a flexible matte cover,
elastic closure, and ribbon marker, the Kim
Parker Floral Journal is ideal for everyday use.
The journal contains 160 lined pages, and is
perfect for the office or on the go. Pair it with
our Kim Parker Pen & Pencil set for a gorgeous
gift. See more of Kim's art at
http://www.kimparker.tv/
[US] Galison | 203 x 140 mm |
160 p | ISBN: 9780735339774 | € 10,60 [BE]/
€ 10,60 [NL] / € 10,60 [INT]| Jan. 2014
Elastic band, ribbon marker
Vintage Cameras Essential
Everyday Journal
[US] Galison | | Eng. ed. | 203 x 140 mm |
160 p | ISBN: 9780735340213 | € 10,50 [BE]
/ € 10,50 [NL] / € 10,50 [INT]| Jan. 2014
Elastic band, Ribbon marker
65
GIFTS
Sketchbook: Andy Warhol
Brooklyn Bridge
Sketchbook: Andy Warhol
Flowers
Take inspiration from one of the preeminent
artists of the 20th century, Andy Warhol. This
dynamic sketchbook features a print from
Warhol's Brooklyn Bridge, 1983 series, which
celebrated the bridges centennial. With 30
sheets of artist-quality drawing paper and a
colour wire binding for easy flipping, this
sketchbook is perfect for any aspiring artist.
Make your drawings "Pop"! Take inspiration
from one of the 20th century's most influential
artists, Andy Warhol. This dynamic sketchbook
features a print from Warhol's Flowers series
on the front cover and 30 sheets of
artist-quality drawing paper. Bound at its top
with a colour wire binding for easy flipping, this
sketchbook is perfect for any aspiring artist.
[US] Galison | Wire-o binding | Eng. ed. | 305
x 229 mm | 30 p | ISBN: 9780735339729 | €
11,50 [BE] / € 11,50 [NL] / € 11,50
[INT]| Jan. 2014
[US] Galison | Wire-o binding | Eng. ed. |
ISBN: 9780735339712 | € 11,50
[BE] / € 11,50 [NL] / € 11,50 [INT]| Jan.
2014
100 Reasons to Panic about
getting old
We've laid out every reason you can think of to
panic about getting older--and all the reasons
it's actually going to be okay.
[US] Knock Knock | Hardback | Eng. ed. |
210 x 150 mm | 112 p | 29 col. & bw ill. |
ISBN: 9781601065773 | € 8,50 [BE] / € 8,50
[NL] / € 8,50 [INT]| March 2014
A perfect gift for anyone over 22 !
Horizontal Pad: What to Pack
Some of our best-selling pads--with a fresh
new 'tude! With a new orientation and freshly
hand-drawn look, these additions are as
charming as they are helpful.
[US] Knock Knock | Pad | Eng. ed. |
60 p | ISBN: 9781601065513 | € 7,95 [BE] /
€ 7,95 [NL] / € 7,95 [INT]| March 2014
Inner Truth: I Need to Unplug
Our new title in this best-selling series
addresses a subject everyone can relate to: the
exhausting effects of digital saturation and
info-overload. Provides a healthy daily dose of
techno-skepticism for the digital age.
[US] Knock Knock | | Eng. ed. |
ISBN: 9781601065810 | € 15,95 [BE] /
€ 15,95 [NL] / € 15,95 [INT]|
March 2014
Dream Journal
Cheaper (and less nosy) than a shrink, this
hand-some bedside analyst offers an easy
format for recording your dreams and
interpreting their signifi-cance. Because
sometimes a cigar is just a cigar-but not
usually.
<ul><li>Explore your subconscious without
paying for actual therapy!!
</li><li>Great for overthinkers, intellects, and
dreamers
</li><li>Paperback; 6.25 x 9 inches, 128
pages, ribbon page marker
</li></ul>
[US] Knock Knock | | Eng. ed. |
ISBN: 9781601065230 | € 14,50 [BE] /
€ 14,50 [NL] / € 14,50 [INT]|
March 2014
Munken: Works M
[G] Steidl | ISBN 9783869306414 |
€ 26?95 [be]
66
GIFTS
Personal Library Kit
The bestselling Personal Library Kit
reintroduces old-fashioned library circulation
techniques for fun and book retention. The kit's
self-adhesive pockets, checkout cards, date
stamper, and keepsake box have bibliophiles
everywhere channeling their inner librarian.
Plus, when the stacks are empty, you can
reload your Personal library Kit with a handy
refill pack !
[US] Knock Knock | Boxed | Eng. ed. | x
mm | p | ISBN: 9781601060723 | € 15,95
[BE] / € 15,95 [NL] / € 15,95 [INT]|
Jan. 2014
Reprint.
Refill pack: isbn 9781601061430
Rotating Stamp: Office Jargon
12 useful expressions
With twelve eminently inkable phrases, this
witty gadget does the talking for you. A
favorite item with a new name!
[US] Knock Knock | | Eng. ed. |
ISBN: 9781601065636 | € 11,95 [BE] / €
11,95 [NL] (CB)/ € 11,95 [INT]| March 2014
Rotating Stamp: Love
12 Love-ly Phrases
With twelve eminently inkable phrases, this
witty gadget does the talking--or
sweet-talking--for you. The mechanical cousin
of candy Valentine's hearts!
[US] Knock Knock | | Eng. ed. |
ISBN: 9781601065469 | € 11,95 [BE] / €
11,95 [NL] / € 11,95 [INT]| March 2014
Magnet Mini Note: Nag Note
Our renowned sticky notes have shape-shifted
into itty-bitty dry-erase boards. Even better,
they're magnetic. Stick 'em to your fridge and
leave a note for your roommate, your spouse,
or yourself.
<ul><li>With a product this cute, it's okay to
nag
</li><li>A honey do list you can reuse until
the end of time
</li></ul>3.75 x 4.25 inches; magnet on
back; includes dry-erase pen
[US] Knock Knock | | Eng. ed. |
ISBN: 9781601065704 | € 6,50 [BE] / € 6,50
[NL] / € 6,50 [INT]| March 2014
67
GIFTS & GAMES
The 1000 Dot-to-Dot Book
The 1000 Dot-to-Dot Book
The 1000 Dot-to-Dot Book
Animals
Cityscapes
Thomas Pavitte
Thomas Pavitte
Twenty Iconic Portraits to Complete
Yourself
Its dot-to-dot gone wild in this latest addition
to the series, as author Thomas Pavitte sets
out to explore the animal kingdom. Enjoy
bringing your favourite animals to life with The
1000 Dot-to-Dot Book: Animals, featuring
popular pets such as cats and dogs, as well as
the more exotic beasts of feathers, fur, and
scales... With 20 incredible drawings for you to
complete at home each consisting of no fewer
than a thousand dots youll discover the unique
pleasure and satisfaction that comes from
joining dots
Following the global success of The 1000
Dot-to-Dot Book, author Thomas Pavitte is now
taking his extraordinary illustrations to the
urban jungle in 1000 Dot-to-Dot Cityscapes.
With 20 incredible drawings of some of the
greatest cities in the world each consisting of
no fewer than one thousand dots and rendered
in amazing detail youll discover the unique
pleasure and satisfaction that comes from
joining dots. Best of all, the fun doesnt end
with the the last dot joined.
Thomas Pavitte
[UK] Ilex | Paperback | Eng. ed. | 356 x 254
mm | 48 p | ISBN: 9781781571446 | € 14,50
[BE] / € 14,50 [NL] / € 14,50 [INT]| June
2014
[UK] Ilex | Paperback | Eng. ed. | 420 x 300
mm | 48 p | ISBN: 9781781571040 | € 14,50
[BE] / € 14,50 [NL] / € 14,50 [INT]|
March 2014 -R/P
2nd Reprint
[UK] Ilex | Paperback | Eng. ed. | 356 x 254
mm | 48 p | ISBN: 9781781571453 | € 14,50
[BE] / € 14,50 [NL] / € 14,50 [INT]| June
2014
Twenty iconic portraits to complete yourself In
an age of childhood fun for grown-ups, we
bring you The Dot-to-Dot Book . Thomas
Pavitte has put together a unique collection of
dot-to-dot drawings, all of them consisting of
exactly , dots and taking a satisfyingly long
time to complete. His unique style, recreating
iconic people and portraits in dot form, results
in images that are not only fun to join, but cool
enough to put on your wall.
Art to Collect and Colour
Pictura: Tomislav Tomic's A Walk
Through Paris
Pictura: Niroot Puttapipat's
Faeries
Art to Collect and Colour
Art to Collect and Colour
Tomislav Tomic
Pictura is a stunning range of black-and-white
artworks to collect and colour, for ages 9 to 90.
In Faeries, young artist Niroot Puttapipat has
created a beautiful woodland scene of elves,
sprites, faeries and other mythical creatures.
After colouring this in, consumers are invited to
take the next creative step and copy Niroot's
work, using a gridded drawing activity on the
back of the concertina.
Pictura is a stunning range of black-and-white
artworks to collect and colour, for ages 9 to 90.
In this title from the urban strand, Tomislav
Tomic takes us on a journey through
glamorous Paris in the early 1900s. There are
eight iconic buildings/places to be coloured in:
Sacre Coeur, Arc de Triomphe, Champs
Elysees, Grand Palais, the Louvre, the Seine,
Notre Dame and, of course, the Eiffel Tower.
[UK] Templar - PIctura | Paperback | Eng. ed.
| 228 x 174 mm | 8 p | ISBN: 9781848776715
| € 11,50 [BE] / € 11,50 [NL] / € 11,50
[INT]| Oct. 2013
68
[UK] Templar - PIctura | Paperback | Eng. ed.
| 228 x 174 mm | 8 p | ISBN: 9781848779846
| € 11,50 [BE] / € 11,50 [NL] / € 11,50
[INT]| Oct. 2013
GIFTS & GAMES
London IQ
The Trivia Game for Londoners
This one-of-a-kind game presents multiple
choice trivia questions about London's historic
nooks and crannies, beloved pastimes,
hotspots and highlights only true Londoners
would know. Correct answers are awarded IQ
points and the team with the highest London
IQ wins! Sleek game components include 200
cards (400 questions), a scoring chart, and 4
coloured pencils.
[US] Chronicle Gifts | Paperback | Eng. ed. |
x mm | 200 p | ISBN: 9781452124599 | €
19,95 [BE] / € 19,95 [NL] / € 19,95 [INT]|
April 2014
Puzzle: Andy Warhol So Series
Deluxe Puzzle Wheel
The charming drawings of the iconic Andy
Warhol's "So Series "adorn this special puzzle
wheel. Hand drawn in the 1950s, Warhol's "so
slow" snails, so happy cat, and "so many stars"
will delight youngsters. The six outer puzzle
pieces each show a different illustration from
the So Series, and fit into a central piece to
form a circle around a smiling sun. As a bonus,
the reverse side is also a colour wheel! These
extra thick pieces fit easily into small hands.
New York Times 1000 PC Puzzle
Get in a New York state of mind by piecing
together this beautiful puzzle. The breathtaking
image was culled from the photo archives of
The New York Times, and shows the city and
the iconic Empire State Building lit up at night.
The New York Times 1000 Piece Puzzle comes
in a sturdy box, and includes an insert of the
image for puzzle-solving reference.
[US] Galison | Boxed | Eng. ed. | x mm | p
| ISBN: 9780735340114 | € 18,50 [BE] / €
18,50 [NL] / € 18,50 [INT]| Feb. 2014
[US] Galison | | Eng. ed. | x mm | p |
ISBN: 9780735339910 | € 15,95 [BE] / €
15,95 [NL] / € 15,95 [INT]| Jan. 2014
Typeface Memory Game
Street Art Memory Game
Make a Face - Memory Game
The Quick Brown Fox Jumps Over The
Lazy Dob
Design: Lilian van Dongen Torman
The cards of this new memory game depict all
kinds of funny faces created with everyday DIY
materials such as paper, cardboard, elastic
bands, brushes, buttons, etcetera.
Your task, as ever, is to find the matching
faces made with the same materials.
Great fun to play for children of every age and,
as a side effect, playing the game also gives
you tons of inspiration for creating your own
faces or other figures with everyday materials.
Joost van Dorst & Sylvia Klop
This very attractively finished typographic
memory game includes 25 variations of the
letter 'A', each in a different letter type. Players
attempt to find the matching A's in the same
letter type. The player who has the highest
number of matching letters wins the game.
Typographic information about the letter is
included on the card, and a separate folder
provides a general history of typography.
[NL] BIS Publishers | Boxed | Eng. ed.| |
ISBN: 9789063692216 | € 19,90
[BE] / € 19,90 [NL] / € 19,90 [INT]| Feb.
2014 -R/P
Reprint
This new title in the series of memory games
celebrates the popular field of international
street art, with works of the most famous
street artists. Your task, as ever, is to find the
matching cards.
In this game you have to match two works by
the same street artist. It may sound a little bit
difficult, but the choice of works will be such
that the player can recognise the matching
cards quite easily.
Great fun to play and you will gain more
knowledge about the iconic and often visually
very engaging
[NL] BIS Publishers | Boxed | No text |
| 60 cards | ISBN: 9789063693220 | € 15,00
[BE] / € 15,00 [NL] / € 15,00 [INT]|
March 2014
-previously announced-
69
[NL] BIS Publishers | Boxed | No text |
| 60 cards | ISBN: 9789063693480 | € 15,00
[BE] / € 15,00 [NL] / € 15,00 [INT]|
April 2014
POPULAR CULTURE
We are Friends with you
Friendswithyou
Founded in 2002 by the artists Samuel Borkson
and Tury Sandoval III, FriendsWithYou is a fine
art collective that has been spreading their
trademarked message of Magic, Luck, and
Friendship(TM) worldwide through its inflatable
cartoon heads and winking art installations.
Together they have forged their admiration
with Takashi Murakami, Yayoi Kusama, and
Arturo Herrera and have instilled in their
artwork the powerful ability to trigger thoughts
of happiness and curiosity in even the most
jaded of audiences.
Index A to Z
Peter Halley
Beginning as a low-budget, oversized fanzine in
1996, index magazine quickly became one of
the most influential small publications in the
US. index had a smart and irreverent voice
that epitomized the late '90s indie ethos.
Featuring conversations between architects,
artists, celebrities, designers, filmmakers,
musicians and writers, the magazine brought
together some of the most relevant cultural
figures who were at that time young and often
unknown, yet have since become cultural icons
or celebrities.
[US] Rizzoli | Paperback | Eng. ed. | 304 x
228 mm | 256 p | 200 col. & bw ill. | ISBN:
9780847842445 | € 46,00 [BE] / € 46,00 [NL]
/ € 46,00 [INT]| April 2014
[US] Rizzoli | Hardback | Eng. ed. | 282 x 228
mm | 240 p | ISBN: 9780847842377 | € 49,50
[BE] / € 49,50 [NL] / € 49,50 [INT]| April
2014
Wanderlust Skulls Journal
Skull Art Prints
Mona Lisa to Marge
By Troy M. Litten
20 Removable Posters
Featuring warning signs from around the globe,
this edgy and design-driven journal is ideal for
evoking a sense of wanderlust and recording
tales of discovery and adventure.
20 removable posters by trend-setting artists,
and fitting into the standard 11 x 14 inch
frame. The 20 works featured on the posters
are by: French, Patrick Thomas, Carissa Rose,
Drew Millward, Dan Stirling, James Joyce,
Dominick Rapone, Boo Davies/Quiltsrÿche,
Noah Scalin, Noma Bar, Paul Alexander
Thornton, Pure Evil, Rich Fairhead, Zeke
Clough, Zoe Dorelli, Craig Robson,
Megamunden, Sarah King, Sergei Sviatchenko
and Andres Guerrero.
How the World's Greatest Artworks
Entered Popular Culture
[US] Chronicle Gifts | Paperback | Eng. ed. |
180 x 127 mm | 192 p | ISBN:
9781452118260 | € 10,60 [BE] / € 10,60 [NL]
/ € 10,60 [INT]| April 2014
[UK] Laurence King | Paperback | Eng. ed. |
355 x 279 mm | 40 p | throughout col. & bw
ill. | ISBN: 9781856699396 | € 24,50 [BE] / €
24,50 [NL] / € 24,50 [INT]| Jan. 2014
70
This highly entertaining exploration of art,
history, and commerce reveals how 30
masterpieces made the journey from image to
icon. How did paintings such as the Mona Lisa,
Birth of Venus, and The Scream achieve
worldwide recognition? Why do certain works
of art populate T-shirts, coffee mugs,
calendars, and advertising? Witty and well
researched, this accessible exploration of visual
and popular culture reveals how particular
works of art have become part of the collective
imagination.
[UK] Prestel | Paperback | Eng. ed. | 240 x
195 mm | 144 p | 172 col.ill. | ISBN:
9783791348773 | € 23,50 [BE] / € 23,50 [NL]
/ € 23,50 [INT]| April 2014
STREET STYLE & GRAPHIC DESIGN
Sneakers
The Complete Limited Editions Guide
U-Dox
100 Ideas that Changed Street
Style
100 Ideas that Changed Street Style is a
look-by-look dissection of the key ideas that
changed the way we dress from the middle of
the 20th century to the present day explaining
the most iconic items of clothing and how they
were worn, what the look was born of, its
cultural background, how it was received and
how it still resonates in fashion today. The
modern wardrobe owes its development not
just to fashion designers in Paris or Milan but
also to gangs and movements brought together
by a shared appreciat
Hiroshi Fijiwara
[UK] Laurence King | Paperback | Eng. ed. |
270 x 210 mm | 216 p | 300 col. & bw ill. |
ISBN: 9781780673417 | € 28,50 [BE] /
€ 28,50 [NL] / € 28,50 [INT]| April 2014
Joseph Ari Aloi AKA JK5
Contributions by Eric Clapton, Mark Parker,
Jean Touitou, Nigo, and Sarah Lerfel
An Archive of Sketches, Tattoos,
Drawings, Paintings,and Objects
Known internationally and variously described
as the Godfather of Streetwear and one of the
founding fathers of Tokyo's Harajuku scene,
Hiroshi Fujiwara exerts a disproportionate
influence over contemporary design culture.
Fujiwara, who had collaborated with the likes
of Malcolm McLaren and Vivienne Westwood as
a teenager in the early 1980s, merged a
seminal interest in punk with hip-hop and skate
culture to become one of Japan's principal
tastemakers.
The first monograph to celebrate the diverse
and eclectic work of one of the true visionaries
of the contemporary art world. This creatively
designed monograph features work that
extends from paintings on canvas to plastic
vinyl toys, from storyboards for animation films
to collages and scratch cards, and from
outlines for tattoo work to a vast collection of
sketchbooks-each completed with such
regularity that they serve as a kind of artist
diary, recording his changing preoccupations.
[US] Rizzoli | Hardback | Eng. ed. | 279 x 215
mm | 256 p | ISBN: 9780847842391 | € 54,00
[BE] / € 54,00 [NL] / € 54,00 [INT]| April
2014
[US] Rizzoli | Paperback | Eng. ed. | 254 x
190 mm | 208 p | 280 col. & bw ill. | ISBN:
9780789327239 | € 46,00 [BE] / € 46,00 [NL]
/ € 46,00 [INT]| March 2014
71
This much-anticipated sequel to the classic
volume Sneakers: The Complete Collectors
Guide is a global survey of, and reference
guide to, the very best and most collectible
limited-edition sneaker designs that have been
released over the last decade.
Each sneaker is accompanied by informative
text and a data box listing Edition, Pack, Year
Released, Original Purpose, Technology and
Extras. An essential purchase for both the
hardcore sneaker freak and the first time
collector.
[UK] T & H | Hardback | Eng. ed. | 197 x 215
mm | 256 p | 500 col.ill. | ISBN:
9780500517284 | € 24,95 [BE] / € 24,95 [NL]
/ € 24,95 [INT]| [02/14]
Tokyo Adorned
The neon, pastels, bows, and vibrant prints of
Tokyo's fashion tribes are unmistakable,
outrageous, and fun. Recognized around the
world, with huge online followings, the city's
style icons are photographed here against
white backgrounds, revealing a new dimen-sion
of personality and emotion in these remarkable
individuals.
[UK] Booth-Clibborn | Hardback | Eng. ed. |
380 x 305 mm | 132 p | throughout col.ill. |
ISBN: 9781861543479 | € 34,50 [BE] / €
34,50 [NL] / € 34,50 [INT]| March 2014
GRAPHIC NOVELS
Expo: 16/1/2014 - 19/4/2014,
Bibliotheca Wittockiana, Brussels
Le Temps des Cités
Het tijdperk van de steden
Drawings from the Gulag
Donation François Schuiten
Schenking van François Schuiten
Danzig Baldaev
Thierry Bellefroid, Tristan Garcia, Thierry
Grillet, Benoît Mouchart, Benoît Peeters, Michel
Wittock
Thierry Bellefroid, Tristan Garcia, Thierry
Grillet, Benoît Mouchart, Benoît Peeters, Michel
Wittock
Cette publication, éditée par le Fonds du
Patrimoine à l'occasion de la donation de
François Schuiten, nous invite à voyager dans
l'univers imaginaire du dessinateur à l'aide des
planches qu'il a données à la Fondation Roi
Baudouin.
Benoît Peeters, son grand ami de toujours, y
évoque les Cités Obscures et Thierry Bellefroid,
l'ouvre de jeunesse de François Schuiten.
Tristan Garcia y porte un regard de philosophe.
Uitgegeven door het Erfgoedfonds naar
aanleiding van de schenking van François
Schuiten neemt de publicatie de bezoeker mee
op ontdekkingstocht door de verschillende
werelden uit de verbeelding van François
Schuiten.
In de publicatie vertelt Benoît Peeters, de
jeugdvriend van François Schuiten over De
Duistere Steden en kijkt Thierry Bellefroid
terug op het jeugdwerk van François Schuiten.
Tristan Garcia benadert het oeuvre dan weer
vanuit het standpunt van de filosoof.
Drawings from the Gulag consists of 130
drawings by Danzig Baldaev describing the
history, horror and peculiarities of the Gulag
system from its inception in 1918. This 'graphic
novel' vividly depicts methods of torture and
mass murder undertaken by the
administration, as well as the atrocities
committed by criminals on their fellow inmates.
[BE] Kon. Boudewijnstichting | Paperback |
French ed. | 240 x 201 mm | 80 p |
throughout col. & bw ill. | ISBN:
9782872127139 | € 8,00 [BE] / € 8,48 [NL] /
€ 8,00 [INT]| Jan. 2014
[UK] T & H, Distributed | Hardback | Eng. ed.
| 200 x 160 mm | 224 p | 130 bw ill. | ISBN:
9780956356246 | € 25,95 [BE] / € 25,95
[NL] / € 25,95 [INT]| March 2014
Reprint
[BE] Kon. Boudewijnstichting | Paperback | NL
ed. | 240 x 201 mm | 80 p | throughout col. &
bw ill. | ISBN: 9789051308327 | € 8,00 [BE] /
€ 8,48 [NL] / € 8,00 [INT]| Jan. 2014
Tintin
The Art of Hergé
By Hergé Museum, Michel Dauber
[US] Abrams | Hardback | Eng. ed. | 210 x
210 mm | 480 p | 320 col.ill. |
ISBN: 9781419710933 | € 39,95 [BE] /
€ 39,95 [NL] / € 39,95 [INT]| March 2014 -R/PReprint
Asterix and the Picts (Hb)
Jean-Yves Ferri (Author), Didier Conrad
(Illustrator), Rene Goscinny (Author), Albert
Uderzo (Author),
The Art of Neil Gaiman
Hayley Campbell
With characters like Coraline and the Sandman
to hos, Neil Gaiman is one of the best-loved
authors in the world today, a creative force in
comics, fiction and the movies and TV, a serial
award-winner, and a social media phenomenon
whose every work is a guaranteed #1
bestseller. Author Hayley Campbell brilliantly
evokes the literary and comics scene of 1980s
London, and places pop-culture milestones in
the context of a busy, multi-stranded creative
life - making sense of Gaimans diverse career.
[UK] Ilex | Hardback | Eng. ed. | 255 x 205
mm | 320 p | ISBN: 9781781571392 | € 36,50
[BE] / € 36,50 [NL] / € 36,50 [INT]| May 2014
Stieg Larsson's
Girl with the Dragon Tattoo
Leonardo Manco (Artist), Andrea Mutti (Artist),
Denise Mina (Author)
Harriet Vanger, a scion of one of Sweden's
wealthiest families, disappeared over forty
years ago. All these years later, her aged uncle
continues to seek the truth. He hires Mikael
Blomkvist, a crusading journalist recently
trapped by a libel conviction, to investigate. He
is aided by the pierced and tattooed punk
prodigy Lisbeth Salander. Together they tap
into a vein of unfathomable iniquity and
astonishing corruption..
[US] Random House US | Hardback | Eng. ed.
| x mm | p | ISBN: 9781401242862 | €
24,99 [BE] / € 24,99 [NL] / € 24,99 [INT]|
April 2014
The Girl who played with Fire,
ISBN 9781401237578
72
[UK] Orion | Hardback | Eng. ed. | 287 x 216
mm | 48 p | throughout col.ill. | ISBN:
9781444011678 | € 13,99 [BE] / € 13,99 [NL]
/ € 13,99 [INT]| Dec. 2013 -R/P
Reprint
GRAPHIC ART & DESIGN
Know Your Onions. Webdesign
Jet propel yourself into the driving seat of
a top-class web designer and be a money
making, creative, design machine
Drew de Soto
Once upon a time I was
Dit boek is als een handig notitieboekje waarin
een ervaren grafisch ontwerper als een
persoonlijke mentor, zijn 20 jaar ervaring voor
je heeft opgeschreven. Dus licht van toon,
zonder omhaal van woorden geschreven en
boordevol tips en adviezen over alle aspecten
van grafisch werk. Een naslagwerkje dat je
altijd bij de hand wil hebben en dat je de
ervaring en inzichten geeft waar een ander
jaren over doet om die op te bouwen.
The autobiography of: ...
Lavinia Bakker
This is a guided diary which helps you
create your own autobiography by means
of questions and space for pictures, little
drawings, lists of your favorite things,
your memories and more. Record
the stories of your life - or a loved one's
- in this keepsake that will be cherished
for generations to come! This diary is
very nicely styled and has an attractive
fresh design, which sets it apart from the
ordinary, mainstream look most of these
diaries usually have.
From Selling to Co-Creating
Régis Lemmens, Bill Donaldson, Javier Marcos
This is a groundbreaking book that identifies
the current and future trends in sales.
It is based on 100+ interviews with senior
sales executives and sales experts from the
corporate industry and academia across central
Europe, the UK and the USA.
This research was supported by TiasNimbas
Business School, Cranfield University and the
Sales Management Association in the
Netherlands.
[NL] BIS Publishers | Paperback with flaps |
Eng. ed. | 210 x 210 mm | 256 p | ISBN:
9789063693510 | € 34,00 [BE] / € 34,00 [NL]
/ € 34,00 [INT]| March 2014
[NL] BIS Publishers | Hardback | Eng. ed. |
220 x 170 mm | 144 p | ISBN:
9789063693466 | € 17,00 [BE] / € 17,00 [NL]
/ € 17,00 [INT]| Feb. 2014
Creativity
The Art and Science of Great Ideas
Many people will tell you that creativity is a
somewhat obscure concept, indefinable even.
This seems a little odd, however, seeing as
creativity is all around us. We can find it in
both the art we admire in a museum and the
newest piece of technology about to change
our lives. But creativity also resides in the
mundane, everyday things.
We all use our creativity, constantly.
[NL] BIS Publishers | Paperback | Eng. ed. |
216 x 140 mm | 144 p | ISBN:
9789063693459 | € 17,00 [BE] / € 17,00 [NL] /
€ 17,00 [INT]| March 2014
73
[NL] BIS Publishers | Paperback | Eng. ed. |
200 x 120 mm | 160 p | ISBN:
9789063693121 | € 17,00 [BE] / € 17,00 [NL]
/ € 17,00 [INT]| Feb. 2014
-Previously announced-
Grids
100 manieren om grids toe te passen
+special price+
Beth Tondreau
The first one-stop reference and resource for
building and using grids in all design projects.
Grids are the basis for all design projects, and
learning how to work with them is fundamental
for all graphic designers. From working with
one column to multicolumn formats using
images, type, color and more. Grids provides
the best information on how to achieve great
design with 100 strategies and examples.
[NL] BIS Publishers | Hardback | NL ed. | 250
x 215 mm | 208 p | ISBN: 9789063692117 |
€ 19,00 [BE] / € 19,00 [NL] / € 19,00
[INT]| Nov. 2009
+special offer: 19,- euro instead of 29,90- euro+
GRAPHIC ART & DESIGN
Graphic Design
Dorian Lucas
Adventures in Letterpress
Letterpress has been undergoing a revival as a
reaction to the widespread digitization of art
and design, this book will appeal to both
designers and crafts enthusiasts. It includes
edgy, witty designs ranging from quirky
political ads and poetry broadsides to
humorous ephemera, animalia, retro and just
plain weird stuff. It features the work of 80
unique presses from across the United States.
[UK] Laurence King | Hardback | Eng. ed. |
240 p | 200 col. & bw ill. | ISBN:
9781780673332 | € 25,95 [BE] / € 25,95 [NL]
( € 25,95 [INT]| Feb. 2014
Graphic design is the creation of visual
contents in various media, whose presentation
conveys information to other people. The field
is interdisciplinary and subject to constantly
changing conditions and different
interpretations. This unusual book presents
130 young designers as well as established
graphic companies, each on a double page
designed by him, her or them. All artists were
given the same sample page and the same
specified font sizes and number of key strokes.
[G] Braun | Hardback | Eng. ed. | 285 x 210
mm | 232 p | 500 col.ill. | ISBN:
9783037681633 | € 43,50 [BE] / € 43,50 [NL]
/ € 43,50 [INT]| March 2014
The True Size of Food
Evolution by Design
Type on Screen
In this richly illustrated book, the designer and
author Marijke Timmerman examines how we
deal with nutrition and food. She goes about
this in a manner that is characteristic for
creative designers: visually, often by means of
infographics, investigation and asking
questions. Her book is no cookbook, nor a book
with commands and restrictions regarding
food. Rather, what fascinates the author is the
incredible abundance of food surrounding us
everywhere.
John Alcorn
A Critical Guide for Designers, Writters,
Developers, and Students
[NL] BIS Publishers | Paperback | Eng. ed. |
220 x 170 mm | 160 p | ISBN:
9789063693497 | € 17,00 [BE] / € 17,00 [NL]
/ € 17,00 [INT]| March 2014
For over three decades, graphic artist, designer
and illustrator John Alcorn (1935- 1992) had a
unique and powerful influence on advertising
and publishing in America and Europe. More
than 500 colour illustrations spanning book
jackets, editorial illustrations, posters, logos,
award-winning children's books, paintings, ads
and even billboards advertising the dominant
pop icons of his age display not just the
striking variety of mediums and styles he
employed, but also the wide range of
sensibilities.
[UK] Moleskine | Hardback | Eng. ed. | 294 x
227 mm | 288 p | throughout col.ill. | ISBN:
9788867321964 | € 56,95 [BE] / € 56,95 [NL]
/ € 56,95 [INT]| March 2014
74
Ellen Lupton
The long awaited follow-up to our all-time
bestseller Thinking with Type is here. Type on
Screen is the definitive guide to using classic
typographic concepts of form and structure to
make dynamic compositions for screen-based
applications. Type on Screen is an essential
design tool for anyone seeking clear and
focused guidance about typography for the
digital age.
[US] Princeton | Paperback | Eng. ed. | 220 x
180 mm | 208 p | 200 col.ill. | ISBN:
9781616891701 | € 21,95 [BE] / € 21,95 [NL]
/ € 21,95 [INT]| May 2014
DESIGN
Formica Forever
Marcel Wanders
Alvar Aalto
Formica Forever, published to celebrate
Formica®s centennial, takes us on a lively,
informative walk through the life of this
much-loved material: from its beginnings as
electrical insulation; to its adoption by
designers including Donald Deskey in the
1930s; to a golden age ushered in by the
postWorld War II housing boom; through
global expansion in the second half of the
twentieth century; to the laminates inventive
uses by designers, artists and architects such
as Jasper Morrison, Daniel Buren, Gehry...
D.A.P.
The Designer Pinned Up
Objects and Furniture Design
This book is a critical survey of Dutch designer
Marcel Wanders covering 25 years of his work,
from his early career to upcoming projects. It
provides a framework for different aspects of
Wanders' designs.
Stedelijk curator Ingeborg de Roode analyses
Wanders' three-dimensional product designs
within an international context, along with an
essay about this renowned designer's career by
Jennifer Hudson and an exclusive interview
with Wanders himself, conducted by Robert
Thiemann.
Patricia de Muga & Sandra Dachs
[UK] T & H, Distributed | Paperback | Eng. ed.
| 235 x 163 mm | 408 p | ISBN:
9781938922152 | € 36,50 [BE] / € 36,50 [NL]
/ € 36,50 [INT]| Jan. 2014
Retro & Vintage Design
Michelle Galindo
'Retro' and 'Vintage' are buzzwords that include
1930s Jägermeister, 1950s Roberts DAB Radio,
and 1970s G Plan Furniture. While Eames
Lounge Chairs, Levis 501, or Chanel N° 5 have
always been popular and evolved into style
icons, other products and styles were (almost)
forgotten. Rediscovered in recent years, some
of them have made a comeback, reaching
unprecedented levels of popularity today and
becoming part of a hip lifestyle.
[G] Braun | Hardback | Eng. ed. | 285 x 210
mm | 232 p | 500 col.ill. | ISBN:
9783037681718 | € 43,50 [BE] / € 43,50 [NL]
/ € 43,50 [INT]| March 2014
Expo: 1/2/2014 - 15/6/2014, Stedelijk
Museum, Amsterdam
This is a superbly illustrated series showcasing
the best design work from some of the 20th
century s finest architects. This engaging new
series is dedicated to showcasing the very best
in furniture and object design from some of the
most important architects of the
Twentieth-century
[ES] Poligrafa | Hardback | Eng. ed. | 196 x
165 mm | 128 p | ISBN: 9788434311435 | €
23,50 [BE] / € 23,50 [NL] / € 23,50
[INT]| Nov. 2007
[NL] Frame | Paperback | NL ed. | 270 x 220
mm | 224 p | ISBN: 9789491727306 | € 29,00
[BE] / € 29,00 [NL] / € 29,00 [INT]| Feb. 2014
The Exceptionally Simple Theory
of Sketching
Sketching
Why Professional Sketches Look Beautiful
For designers, sketching is a daily activity that
can serve many goals. You can sketch to
brainstorm, to find and articulate ideas or to
present a project to other designers in your
team or people from other departments. And of
course you sketch to present projects to clients
and production companies.
George Hlavács
People who cannot draw well usually think that
professional sketching is a complex and difficult
process. However, after reading this book you
will see that even the most complex sketches
are just a structure of very simple, yet
confidently drawn segments built on each
other.
The author shows which features exactly make
drawings look professional and how you can
implement those in your own sketches.
[NL] BIS Publishers | Paperback | Eng. ed. |
220 x 175 mm | 64 p | ISBN: 9789063693343
| € 15,00 [BE] / € 15,00 [NL] / € 15,00
[INT]| March 2014
-previously announced-
75
Product Design Presentation
[NL] BIS Publishers | Hardback | Eng. ed. |
270 x 210 mm | 192 p | ISBN:
9789063693299 | € 34,00 [BE] / € 34,00 [NL]
/ € 34,00 [INT]| Sept. 2014
HIRTAGE & LOCAL INTERES
Hoven van Plaisantie
Het 'soete' buitenleven in de provincie
Antwerpen. 16de-20ste eeuw
Prof. dr. R. Baetens
Laat u meeslepen in een ontdekkingstocht
langs parken en kastelen, bekend, verborgen
of verdwenen in de tijd. Vele feiten en verhalen
tekenen een quasi volledig beeld van het
buitenleven rond Antwerpen dat u
gegarandeerd zal boeien, soms herkennen en
bovenal verrassen.
Het boek is verlucht met talrijke grotendeels
onbekende illustraties uit archieven, musea en
privébezit.
[BE] Pandora | Hardback | NL ed. | 297 x 235
mm | 320 p | throughout col.ill. | ISBN:
9789053253670 | € 55,00 [BE] / € 55,00 [NL]
/ € 57,83 [INT]| Dec. 2013
Op koers naar Wereldhaven en
Maritiem Museum
750 Jaar Havenkranen in
Antwerpen
Eric van Hooydonk
Dit rijk geïllustreerde boek brengt voor het
eerst een overzicht de geschiedenis van 750
havenkranen in Antwerpen. Toen de stad in
1974 de hydraulische havenwerktuigen buiten
bedrijf stelde, besliste ze om een
'technologisch archief' of een museumcollectie
van havenkranen aan te leggen. Het MAS
beheert op dit moment de grootste en meest
diverse museale collectie havenkranen ter
wereld met 18 kranen van 15 binnen- en
buitenlandse constructeurs.
Na de reddingsactie voor de laatste Congoboot
Charlesville geniet het scheepvaart- en
havenerfgoed overal aandacht. Maar welke
toekomst hebben onze maritieme musea?
In Antwerpen, Baasrode en Oostduinkerke zijn
prachtige maritieme themamusea opengegaan.
Is daarnaast nog plaats voor een algemeen
maritiem museum? Een klassiek museum, of
een internationale 'superstar' die 1 miljoen
bezoekers per jaar aanlokt?
En kan de Charlesville nog worden gered?
[BE] Pandora | Hardback | NL ed. | 280 x 240
mm | 360 p | ISBN: 9789053253663 | € 49,00
[BE] / € 49,00 [NL] / € 46,23 [INT]| Dec.
2013
[BE] BAI - MAS Books | Hardback | Dutch (NL)
& Eng. eds. | 285 x 210 mm | 176 p | 200 col.ill. |
ISBN: 9789085866664 (NL) | 9789085866671 (Eng) |
€ 29,50 [BE] / € 29,50 [NL] / € 29,50 [INT]|
Feb. 2014
Visit Antwerp Guide
Bottoms up in Belgium
Ontdek Antwerpen
Seeking the High Points of the Low Land
PRO-POSITIONS:
Art and / as education
Welkom in Antwerpen !
Dit praktisch gidsje heeft de ambitie je snel
wegwijs te maken in onze stad. Het is
opgedeeld in acht wijken, elk met hun eigen
karakter. Of je hier komt voor een stevige
portie cultuur, om geschiedenis te snuiven, te
shoppen of culinair te genieten, het kanin elke
wijk en in de hele stad.
Antwerpen is compact, maar heeft veel te
bieden. Aan jou om het te ontdekken. Geniet
ervan !
Alec Le Sueur
Royal Academy of Fine Arts Antwerp
Immersing himself in Belgian culture - and
sampling the local beer and 'cat poo' coff ee
along the way - he discovers a country of
contradictions; of Michelin stars and processed
food, where Trappist monks make the best
beer in the world and grown men partake in
vertical archery and watch roosters sing (not
necessarily at the same time). This colourful
and eccentric jaunt is proof that Belgium isn't
just a load of waffle.
Editors: Johan Pas, Nico Dockx & Els De bruyn
[BE] BAI - Special prices | Paperback | NL ed.
| 210 x 147 mm | 102 p | throughout col.ill. |
ISBN: 9789085866619 | € 1,00 [BE] / € 1,00
[NL] / € 1,00 [INT]| Feb. 2014
[only for sale per 32 copies - special
conditions]
[UK] Summersdale Publishers | Paperback |
Eng. ed. | 198 x 129 mm | 320 p | ISBN:
9781849532471 | € 12,95 [BE] / € 12,95 [NL]
/ € 12,95 [INT]| Jan. 2014
76
Is it possible to combine the historical
dimension of the art academy with the
intention of becoming a laboratory for
advanced artistic research? The double
publication CONTRADIcTIONS &
PRO-POSITIONS is part of a strategy to face
this challenge. The second volume
PRO-POSITIONS is more international in scope,
and contradicts and interacts with the first.
PRO-POSITIONS: Art and / as Education
focuses on artist-driven pedagogies and
educational projects,with different artists and
authors contributing .
[BE] AsaMER | Hardback | Eng. ed. | 280 x
216 mm | 302 p | ISBN: 011187 | € 35,00
[BE] / € 35,00 [NL] / € 33,02 [INT]| April
2014
ANTIQUES, COLLECTABLES & JEWELLERYN
Kunst- en Antiekveiling 2014
(#38)
Wat zijn sculpturen waard?
Reinold Stuurman & Janny Stuurman
Deze zeer bruikbare handleiding voor het
herkennen en beoordelen van sculpturen en is
een onmiskenbare wegwijzer bij aankoop.
In dit boek vindt u ruim 2.200 voorbeelden van
sculpturen met een bescheiden prijs tot en met
kostbare topstukken. Van de vroege
middeleeuwen tot en met de 20ste eeuw en
met richtprijzen.
De afbeeldingen staan voor zover gesigneerd
op alfabet en indien anoniem op leeftijd in
rubrieken van de diverse materiaalsoorten.
De waarde-beoordeling is vastgesteld door
specialisten.
Deze nieuwe editie is volledig in kleur gedrukt !
De succesvolle reeks Kunst-en Antiekveiling
bestaat al ruim drie decennia. Voor de
liefhebbers en verzamelaars van kunst en
antiek is prijs informatie essentieel. Kunst-en
Antiekveiling verschaft die informatie in
combinatie met adequate beschrijvingen en
afbeeldingen van de voorwerpen. Dit
jaaroverzicht, inmiddels het 38ste deel, bevat
maar liefst 3500 voorwerpen welke zijn
verkocht op de kunst- en antiekveilingen in
Nederland en België.
[NL] Scriptum Art | Hardback | NL ed. | x
mm | p | ISBN: 9789055947997 | € 59,95
[BE] / € 59,95 [NL] / € 59,95 [INT]| Feb.
2014
Janny & Reinold Stuurman
[NL] Scriptum Art | Paperback | NL ed. | 240
x 170 mm | 300 p | 2200 bw ill. | ISBN:
9789055943579 | € 29,95 [BE] / € 29,95
[NL] / € 31,80 [INT]| Feb. 2014
Miller's Collectables Handbook &
Price Guide 2014-2015:
The Indispensable Guide to What It's
Really Worth!
Judith MIller and Mark Hill
This is the up-to-date guide to the collectables
market. -Featuring more than 4,000 objects in
full colour, each with a detailed description and
current price range, the book also offers what
those in the know look for - how to spot that
rare example that may be worth twenty times
more than another piece, or why now is the
moment to buy Roseville pottery. Meanwhile,
in-depth closer look features explain what to
look for when appraising everything from 20th
century glass to costume jewellery.
[UK] M. Beazley | Paperback | Eng. ed. | 235
x 194 mm | 432 p | 4000 col.ill. | ISBN:
9781845337308 | € 0,00 [BE] / € 0,00 [NL] /
€ 0,00 [INT]| April 2014
Trésors cachés d'une
bibliothèque
Les livres d'artistes collectionnés par Anne
Gruner-Schlumberger amie des peintres et des
sculpteurs qu'elle invitait en résidence dans son
domaine du Var, Les Treilles, seront exposés
pour la première fois. L'exposition présentera
une trentaine d'ouvrages rares, des dessins
originaux, des sculptures et un meuble-lutrin
de la bibliothèque des Treilles.
Expo: 06/03/14 - 01/06/14, Galerie d'art
d'Aix en Provence
[IT] Silvana | Paperback with flaps | French/
It. ed. | 280 x 240 mm | 168 p | 150 col.ill. |
ISBN: 9788836628025 | € 22,00 [BE] / €
23,40 [NL] / € 22,00 [INT]| March 2014
SCENES, Thalen & Thalen
Rob & Jaap Thalen
De puurheid en schijnbare eenvoud van hun
ontwerpen doen hun werk moeiteloos lijken.
Het is een bewijs van hun uitstekende
vakmanschap. De bron van hun werk is hun
passie en liefde voor zilver. Hun talent voor
design en hun inzicht in de mogelijkheden van
het fijnzilver maken het werk van Thalen &
Thalen zo speciaal. Hun meest recente werk is
tegelijkertijd bruikbaar en in zijn puurheid
schitterend uitgewerkt.
77
Expo: 15/12/2013-01/05/2014,
Zilvermuseum Sterckshof, Antwerpen
[BE] Stichting Kunstboek | Hardback | E/ F/
NL/ G ed. | 230 x 230 mm | 192 p | ISBN:
9789058564825 | € 29,90 [BE] / € 29,90 [NL]
/ € 29,90 [INT]| Feb. 2014
KIDS
10 times 10
Beet
Hervé Tullet
Vindingrijke vangsten rond kookkunsten
A fun counting book, written with Herve Tullet's
buoyant and irreverent humour. Presenting ten
ways to count to ten: 1. With numbers 2. With
fingers 3. With paints 4. With a portrait - well,
an abstract one! .....
Niet door te koken maar door te bouwen, te
knutselen en te creëren, maak je de keuken
mooier, de tafel romantischer, de vuilnisbak
leger, de muur leuker en de plakband op!
[UK] Tate | Hardback | Eng. ed. | 190 x 190
mm | 128 p | throughout col.ill. | ISBN:
9781849762472 | € 13,95 [BE] / € 13,95 [NL]
/ € 13,20 [INT]| Jan. 2014
Het zijn de dames Karen van Gulik en Celesta
Daniëls die kinderen weten te motiveren om te
beginnen knutselen.
In BEET worden er een tiental
kook-kunstwerkjes gemaakt. Een mooi
gedecoreerde vis van een ovenwant, een
zilveren kandelaar voor midden op de tafel,
een scheetzak om oma te foppen en veel meer.
[BE] Minestrone | Paperback | NL ed. | 280 x
200 mm | 32 p | throughout col.ill. | ISBN:
9789490028589 | € 14,50 [BE] / € 14,50 [NL]
/ € 14,50 [INT]| Dec. 2013
Art: A World of Words
Hieronymus Bosch
Flowers
First Paintings-First Words in 12
Languages
Colouring Book
Make Your Own Mobile Inspired by Emil
Nolde
Doris Kutschbach
Big art for little hands, these enchanting
activity books allow young artists to explore
the world's masterpieces on their own terms
and with plenty of space to colour outside the
lines. This delightful children's activity book is
published to mark the 75th year since the
Prado in Madrid acquired the Garden of Earthly
Delights triptych and the quincentenary of the
artist's death in 2016.
This beautiful introduction to art and language
features some of the world s most loved
masterpieces as it entices children to discover
art, language, objects, and colours. First
pictures, first words this familiar and
time-proven book concept for young children is
incorporated brilliantly in this multi-lingual art
book. The works of Renoir, Kandinsky, Dürer,
Rousseau, Franz Marc, and others are featured
in beautiful full-page reproductions. Opposite
each image is a word that helps describe the
painting for
Sabine Tauber
[UK] Prestel | Paperback | Eng. ed. | 240 x
280 mm | 32 p | 16 col.ill. | ISBN:
9783791371764 | € 6,95 [BE] / € 6,95 [NL]
/ € 6,95 [INT]| Feb. 2014
[UK] Prestel | Hardback | Eng. ed. | 220 x 220
mm | 160 p | 80 col.ill. | ISBN:
9783791371740 | € 21,00 [BE] / € 21,00 [NL]
/ € 21,00 [INT]| March 2014
Padded hardcover
78
As a form of sculpture, few objects rival
mobiles for their versatility and enjoyment.
Whether dangled over a child's crib or artfully
hung in a living room, mobiles are one of the
most popular forms of home decoration. But
they are also an ingenious example of
equilibrium and kinetic movement that can
mesmerize and inspire. Aimed at children five
years and older, this unique book provides the
basic materials for making a beautiful and
colorful mobile that celebrates flowers' endless
varieties and hues.
[UK] Prestel | Paperback | Eng. ed. | 280 x
240 mm | 16 p | 16 col.ill. | ISBN:
9783791371887 | € 9,95 [BE] / € 9,95 [NL]
/ € 9,95 [INT]| Feb. 2014
+5
KIDS
Artcards: Accessorize
Maps
Nina's Book of Little Things
-over 600 stickers and 16 artcards to stick
and style-
Aleksandra Mizielinska, Daniel Mizielinski
by Keith Haring
This book of maps is a visual feast for readers
of all ages, with lavishly drawn illustrations
from the incomparable Mizielinskis. The maps
show not only borders, cities, rivers, and
peaks, but also places of historical and cultural
interest, eminent personalities, iconic animals
and plants, cultural events and many more
fascinating facts associated with every region.
Make a little mess, collect some little
snowflakes and draw the things a little bird
said in this book which asks its owner to make
their mark on every page. Keith Haring
presented Nina's Book to his friend's daughter
on her seventh birthday. Now everybody can
enjoy this classic book reborn in a stylish, new
edition, featuring a back-page pocket to stow
extra little things in.
Hennie Haworth
Introducing ARTCARDS: original pieces of art
made for you - and made by you! Set your
imagination free with 16 pull-out ARTCARDS to
colour in and decorate with 20 pages
containing over 600 stickers. With cheeky
editorial and highly detailed contemporary
illustrations from up-and-coming designer
Hennie Haworth, this is a fresh take on a
favourite activity format that will appeal to
children and teens alike.
[UK] Templar - Big Picture Press | Hardback |
Eng. ed. | 370 x 270 mm | 112 p | ISBN:
9781848773011 | € 28,50 [BE] / € 28,50 [NL]
/ € 28,50 [INT]| Oct. 2013
[UK] Templar - Big Picture Press | Pad | Eng.
ed. | 285 x 190 mm | 72 p | ISBN:
9781848779020 | € 18,95 [BE] / € 18,95 [NL]
/ € 18,95 [INT]| Sept. 2014
[UK] Templar - Big Picture Press | Flexi (Pb
luxe) | Eng. ed. | 270 x 210 mm | 80 p |
ISBN: 9781848773288 | € 21,50 [BE] / €
21,50 [NL] / € 21,50 [INT]| Sept. 2013
+ 6 years
+ 6 years (incl 20 sheets of stickers)
Walk This World
The Little Prince
Lotta Niemenen
A. de Saint-Exupéry
A composite of global cultures, Walk this World
celebrates the everyday similarities as well as
the exotic differences that exist between
cultures around the world. Travel to a new
country with every turn of the page, each with
new surprises to discover: peep through
windows, open doors and delve underground
by opening the many lift-flaps designed into
every spread.
A beautifully bound gift edition of this touching
and wise classic book for children. A pilot
stranded in the desert awakes one morning to
see, standing before him, the most
extraordinary little fellow. "Please," asks the
stranger, "draw me a sheep." And the pilot
realizes that when life's events are too difficult
to understand, there is no choice but to
succumb to their mysteries. He pulls out pencil
and paper . . . Thus begins this wise and
enchanting fable.
[UK] Templar - Big Picture Press | Hardback |
Eng. ed. | 207 x 300 mm | 12 p | ISBN:
9781848778245 | € 24,50 [BE] / € 24,50 [NL]
/ € 24,50 [INT]| Oct. 2013
[UK] Egmont Publishers | Paperback | Eng. ed.
| 198 x 126 mm | 96 p | throughout col.ill. |
ISBN: 9780749707231 | € 9,99 [BE] / € 9,99
[NL] / € 9,99 [INT]| Jan. 2014 -R/P
+ 5 years. With over 80 flaps to open !
Also available: New luxury edition (isbn
9781405264198)
79
CALENDARS & DIARIES
2015 Daily Calendar: Disney
This daily calendar focuses on the final frames
and concept art of Disney's most loved
animated features and shorts. Each page of the
calendar includes a full-colour image from one
of Disney's classic films (or from its production)
and text comprised of either plot descriptions,
quotes from the movies, movie trivia, or
information about the art and/or artist. This
calendar will focus on the more classic titles
from the golden ages of Disney movies.
2015 Engagement Calendar:
Anne Taintor
2015 Engagement Calendar:
Listography
This bestselling Anne Taintor engagement
calendar features vintage ads juxtaposed with
punchy one-liners is back for another year of
hilarity and snark.
Listography for 2015! This illustrated
engagement calendar features entertaining and
thought-provoking list topics, plus plenty of
space to jot down notes and create
personalised lists. Prompts range from
autobiographical (childhood memories,
favourite artists) to aspirational (places to visit,
goals for the New Year).
[US] Chronicle Gifts | Wire-o binding | Eng.
ed. | x mm | 116 p | ISBN: 9781452118734
| € 15,95 [BE] / € 15,95 [NL] / € 15,95
[INT]| July 2014
[US] Chronicle Gifts | Pad | Eng. ed. | x mm
| p | ISBN: 9781452122250 | € 14,50 [BE] /
€ 14,50 [NL] / € 14,50 [INT]| July 2014
2015 Wall Calendar: Anne Taintor
This bestselling Anne Taintor wall calendar
featuring vintage ads with post-modern quips
is back for another year of bad behaviour and
hilarious wit.
[US] Chronicle Gifts | Stapled | Eng. ed. | 300
x 300 mm | p | ISBN: 9781452118741 | €
14,50 [BE] / € 14,50 [NL] / € 14,50
[INT]| July 2014
2015 Wall Calendar Darth Vader
and Son
Jeffrey Brown
Celebrate a year of life lessons with Darth
Vader as he rules the Galactic Empire while
keeping an eye on his daughter Leia in this wall
calendar by Jeffrey Brown, the author and
illustrator of the breakout bestsellers Darth
Vader and Son and Vader's Little Princess.
[US] Chronicle Gifts | Paperback | Eng. ed. |
304 x 304 mm | 24 p | throughout col.ill. |
ISBN: 9781452128153 | € 14,50 [BE] / €
14,50 [NL] / € 14,50 [INT]| July 2014
80
[US] Chronicle Gifts | Paperback | Eng. ed. |
x mm | 128 p | ISBN: 9781452131450 | €
15,95 [BE] / € 15,95 [NL] / € 15,95
[INT]| July 2014
2015 Wall Calendar: Grumpy Cat
The Grumpy Cat Wall Calendar delivers twelve
more months of Grumpy Cat's bad attitude to
her growing number of super-fans.
[US] Chronicle Gifts | Paperback | Eng. ed. |
300 x 300 mm | p | ISBN: 9781452128160 |
€ 14,50 [BE] / € 14,50 [NL] / € 14,50
[INT]| July 2014
CALENDARS & DIARIES
2015 Wall Calendar: I Could
Chew on This
2015 Wall Calendar: I Could Pee
on This
By Francesco Marciuliano
This 2015 wall calendar features adorable cats
accompanied by cheeky poems of the best
material from I Could Pee on This new to this
year's calendar, plus 6 brand new poems by
our furry friends.
[US] Chronicle Gifts | | Eng. ed. | 300 x 300
mm | p | ISBN: 9781452131269 | € 14,50
[BE] / € 14,50 [NL] / € 14,50 [INT]| July
2014
[US] Chronicle Gifts | Stapled | Eng. ed. | 300
x 300 mm | p | ISBN: 9781452128177 | €
14,50 [BE] / € 14,50 [NL] / € 14,50
[INT]| July 2014
81
French Country
2015 Diary
Birdhouses of the World
2015 Wall Calendar
Chihuly
2015 Wall Calendar
-16month calendar-
-16month calendar-
[US] Abrams | Eng. ed. | 305 x 305 mm |
24 p | ISBN: 9781419712630 |
€ 12,95 [BE] / € 12,95 [NL] / € 12,95 [INT]
[US] Abrams | Eng. ed. | 305 x 305 mm |
24 p | ISBN: 9781419713323 |
€ 12,95 [BE] / € 12,95 [NL] / € 12,95 [INT]
[US] Abrams | Eng. ed. | 305 x 305 mm |
24 p | ISBN: 9781419713064 |
€ 12,95 [BE] / € 12,95 [NL] / € 12,95 [INT]
Extraordinary Chickens
2015 WallCalendar
French Country
2015 Wall Calendar
Lil Bub
2015 Wall Calendar
-16month calendar-
-12month calendar-
-16month calendar-
[US] Abrams | Eng. ed. | 305 x 305 mm |
24 p | ISBN: 9781419712616 |
€ 12,95 [BE] / € 12,95 [NL] / € 12,95 [INT]
[US] Abrams | Eng. ed. | 305 x 305 mm |
24 p | ISBN: 9781419712623 |
€ 12,95 [BE] / € 12,95 [NL] / € 12,95 [INT]
[US] Abrams | Eng. ed. | 305 x 305 mm |
24 p | ISBN: 9781419713354 |
€ 12,95 [BE] / € 12,95 [NL] / € 12,95 [INT]
Planet Golf
2015 Wall Calendar
-16month calendar[US] Abrams |
Eng. ed. | 305 x 356 mm | 24 p |
ISBN: 9781419712654 |
€ 12,95 [BE] / € 12,95 [NL] / € 12,95 [INT]|
Treehouses of the World
2015 Wall Calendar
Chihuly
2015 Weekly PlannerDiary
-16month calendar[US] Abrams | Eng. ed. | 368 x 267 mm |
24 p | ISBN: 9781419712661 |
€ 12,95 [BE] / € 12,95 [NL] / € 12,95 [INT]|
[US] Abrams | Eng. ed. | 216 x 159 mm |
160 p | 50 col.ill. | ISBN: 9781419713057 |
€ 12,95 [BE] / € 12,95 [NL] / € 12,95 [INT]
',675,%87('38%/,6+(56
%(/*,80
$6%RRNV
$IULFDPXVHXP7HUYXUHQ
%$,
(G)UDQoRLVH%ORXDUG
(UIJRHG
)RQGV0HUFDWRU
)208)RWRPXVHXP$QWZHUSHQ
+RPDUXV
/D/HWWUH9ROpH
0DF
V*UDQG+RUQX
0DURW(GLWLRQV
0(5SDSHUNXQVWKDOOH
0HUFDWRUIRQGV
0LQHVWURQH
2RJDFKWHQG
3DQGRUD
60$.
6WLFKWLQJ.XQVWERHN
7LMGVEHHOG3LqFH0RQWpH
9$,
9G+%RRNV
<HOORZ1RZ
)5$1&(
)ODPPDULRQ(QJWLWOHV
63$,1
/LQNV
3ROLJUDID
Promo Press
,7$/<
Silvana
*(50$1<
%UDXQ
'DDE
+DWMH&DQW]
Hirmer Verlag
6FKLUPHU0RVHO
6WHLGO
7H1HXHV
8.
Aurum
%RRWK&OLEERUQ
%ULWLVK0XVHXP3UHVV
Carlton
&KULV%RRW
&RQWUDVWR
'.
Gibbs Smith
/DXUHQFH.LQJ
1DWLRQDO3RUWUDLW*DOOHU\
2FWRSXV
3HQJXLQ8.
4XDGULOOH
3UHVWHO
Princeton
4XD\VLGH3XEOLVKLQJ
5RXJK*XLGH
5R\DO$FDGHP\
6FULSWXP
7DWH3XEOLVKLQJ
Templar
7KDPHV+XGVRQ
9$
7+(1(7+(5/$1'6
%,6 Publishers
+HUPLWDJH0XVHXP
+Y'3XEOLVKLQJ
0XVHXP%RLMPDQVYDQ%HXQLQJHQ
1LHXZH.HUN
3HSLQ3UHVV
6FULSWXP$UW3XEOLVKHUV
6WRNHUNDGHVHOHFWLH
9DQ*RJK0XVHXP
6:,76(5/$1'
)RQGDWLRQ*LDQDGGD
86
$EUDPV
$PPR%oRNV
&KURQLFOH
&ROOLQV'HVLJQ,QW
O
Galison
Knock Knock
Monacelli Press
Powerhouse Books
Random House US
5L]]ROL
6WHUOLQJ
VHYHUDO*DOOHULHV0XVHXPV
DQGRFFDFLRQDOSXEOLVKHUV
ZZZH[KLELWLRQVLQWHUQDWLRQDOEH

タトル出版8月新刊 - チャールズ・イー・タトル出版

522: Contemporary Theology

Presentatie Jeroen Kortmann - Vereniging voor Mededingingsrecht

情報エСй

Unit D - Bangabandhu Sheikh Mujibur Rahman Science

1 Extra tentamenmogelijkheden 7e semester 1 Ir. SBVZ Robertson

NISL NEWS 20 - The Netherlands International School Lagos

NISL NEWS 25 - The Netherlands International School Lagos

EP241 lab sheet 6

Agenda FOSS Strategy Road Mapping Event 26 June 2014