MAGNETIC RESONANCE IN CHEMISTRY Magn. Reson. Chem. 2001; 39: 477–483 Structure and folding of glucagon-like peptide-1-(7–36)-amide in aqueous trifluoroethanol studied by NMR spectroscopy Xiaoqing Chang,1† Danielle Keller,1 Søren Bjørn2 and Jens J. Led1∗ 1 2 Department of Chemistry, University of Copenhagen, The H. C. Ørsted Institute, Universitetsparken 5, DK-2100 Copenhagen Ø, Denmark Health Care Discovery, Novo Nordisk A/S, Novo Alle, DK-2880 Bagsværd, Denmark Received 21 February 2001; Revised 12 April 2001; Accepted 20 April 2001 The conformational changes of free, monomeric glucagon-like peptide-1-(7–36)-amide (GLP-1) in aqueous solution with increasing concentrations of 2,2,2-trifluoroethanol (TFE) were monitored by NMR spectroscopy. It was found that GLP-1 gradually assumes a stable, single-stranded helical structure in water solution when the TFE concentration is increased from 0 to 35% (v/v). No further structural changes were observed at higher TFE concentrations. The structure of GLP-1 in 35% TFE was determined from 292 distance restraints and 44 angle restraints by distance geometry, simulating annealing and restrained energy minimization. The helical structure extends from T7 to K28, with a less well-defined region around G16 and a disordered six-residue N-terminal domain. The folding process of GLP-1 from random coil (in water) to helix (in 35% TFE) is initiated by the formation of the C-terminal segment of the helix that is extended gradually towards the N-terminus of the peptide with increasing concentration of TFE. The exchange rates of the slow exchanging amide protons indicate that the C-terminal part of the helix is more stable than the N-terminal part. Copyright 2001 John Wiley & Sons, Ltd. KEYWORDS: NMR; 1 H NMR; 13 C NMR; GLP-1; solution structure; folding; trifluoroethanol INTRODUCTION Glucagon-like peptide-1-(7–36)-amide (GLP-1) is a 30 amino acid peptide with the sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 . It is an incretin hormone that can potentiate glucose-induced insulin secretion, stimulate insulin biosynthesis and inhibit glucagon secretion.1 Accordingly, it is a potential drug for the treatment of non-insulin-dependent diabetes mellitus (NIDDM or type II diabetes2 ). However, GLP-1 suffers from physical instability. Thus it has been found that the conformation, aggregation and solubility of GLP-1 depend on the purification procedure and the in-process storage and handling.3,4 Efforts have been made to characterize the structural properties of GLP-1 in Ł Correspondence to: J. J. Led, Department of Chemistry, University of Copenhagen, The H. C. Ørsted Institute, Universitetsparken 5, DK-2100 Copenhagen Ø, Denmark. E-mail: [email protected] †Present address: Ontario Cancer Institute, University of Toronto, 610 University Avenue, Toronto, Ontario, Canada M5G 2M9. Contract/grant sponsor: Danish Technical Research Council; Contract/grant number: 16-5028-1; 9601137. Contract/grant sponsor: Danish Natural Science Research Council; Contract/grant number: 9400351; 9502759; 9601648; 9801801. Contract/grant sponsor: Ministry of Industry; Contract/grant number: 85886. Contract/grant sponsor: Julie Damm’s Studiefond. Contract/grant sponsor: Direktør Ib Henriksens Fond. Contract/grant sponsor: Carlsbergfondet. Contract/grant sponsor: Novo Nordisk Fonden. DOI: 10.1002/mrc.880 greater detail,4 including its aggregation behaviour in solution, but so far only limited structural information about GLP-1 has been reported. However, the ˛-helix seems to be an important structural motif of GLP-1 in solution. Thus it was found that GLP-1 can form oligomers with a high helical content,3 – 5 and that it is mainly helical in membrane-like environments (dodecylphosphocholine micelle6 ). However, ˇ-sheet formation also seems significant and can lead to less soluble GLP-1 aggregates3 . In order to obtain a more detailed insight into the structure and folding propensity of GLP-1 in solution, we studied the conformation of GLP-1 in mixtures of water and 2,2,2-trifluoroethanol (TFE) using NMR spectroscopy. Organic solvents such as TFE are known to promote helical conformations in proteins and peptides while impeding the specific tertiary interactions of native proteins. This holds especially at high concentrations of TFE, possibly because of its ability to enhance internal hydrogen bonding in polypeptides and to lessen hydrophobic interactions between residues distant in the amino acid sequence.7 Sonnichsen et al.8 noted that, in general, TFE stabilizes ¨ helices in regions that have a high propensity for helix formation. Furthermore, Hamada et al.9 suggested that the intrinsic helical propensity of a peptide fragment elicited by the addition of TFE is not necessarily related to the secondary structure in the native state. It has also been reported that TFE can stabilize the folded state,10 possibly by Copyright 2001 John Wiley & Sons, Ltd. 478 X. Chang et al. explicitly strengthening intramolecular hydrogen bonding.11 Alternatively, Kentsis and Sosnick12 proposed that TFE exerts its helix-stabilizing effects by a mechanism that promotes desolvation of the polypeptide backbone, rather than by strengthening the hydrogen bonds. On the basis of these helix-promoting and -stabilizing effects of TFE, and the observed ˛-helix propensity of GLP-1, a study of the structure and folding of GLP-1 in water–TFE mixtures is interesting in order to obtain a more detailed insight into the structure and folding of GLP-1 in solution. EXPERIMENTAL Sample preparation Lyophilized, recombinant GLP-1 peptide was dissolved in H2 O (with 10% D2 O) or in 99.96% D2 O. The concentration of GLP-1 in the NMR samples was 1.4 mM. The pH was 2.5 (meter reading) in order to minimize the exchange rates of the amide protons of the backbone.13 The TFE concentrations varied from 0 to 50%. Perdeuterated TFE (TFE-d3 ) was used in all cases. NMR spectroscopy The NMR spectra were recorded on Varian Unity Inova 500, 750 and 800 MHz spectrometers and on a Bruker AM500 spectrometer. The three Varian spectrometers were equipped with gradient probes. Standard NMR methods based on 1 H DQF-COSY,14 TOCSY,15 NOESY,16 and 13 C HSQC17 spectra were used for the sequential assignments of the proton resonances of GLP-1 at different TFE concentrations and the assignment of the 13 C resonances at 35% TFE. All spectra were recorded at 300 K. Mixing times of 30, 60 and 90 ms were used in the TOCSY experiments while 50, 100, 150 and 250 ms were used in the NOESY experiments. The 1 H– 1 H correlated spectra were recorded with a sweep width of 8000–10 000 Hz in both dimensions. In the HSQC spectra the sweep width of the carbon dimension was 30 000 Hz (at 800 MHz). All spectra were recorded with 4096 data points in the t2 dimension and the number of increments in the t1 dimension was between 450 and 512. Qualitative discrimination between slow- and fast-exchanging amide protons was achieved by recording 11 h NOESY spectra immediately after dissolving the sample in 99.96% D2 O with the desired TFE concentration, and defining the amide protons still giving rise to cross peaks as slowly exchanging. Quantitative estimates of the amide proton exchange rates were obtained from the linewidth of the signals in the above NOESY spectrum, using a linear prediction-based method described previously.18 Structure calculation of GLP-1 Interproton distance restraints were obtained from the NOESY spectra with the mixing time m D 250 ms. The small size of the GLP-1 peptide and the lower viscosity of the mixed H2 O–TFE solvent as compared with pure water ensured that spin diffusion plays only a minor role at this mixing time and applied temperature (300 K). This conclusion is supported by the observation that the cross peak intensities vary Copyright 2001 John Wiley & Sons, Ltd. approximately linearly in the applied range of mixing times (50–250 ms), and extrapolate to zero at m D 0. The intensities of the NOE cross peaks were determined quantitatively by a combination of linear prediction analysis and least-squares estimation19,20 and classified as strong, medium and weak by comparison with the intensity of the well-resolved 1 Hυ – 1 Hε ˚ The corresponding cross peak of Tyr13 (rHυ Hε D 2.49 A). ˚ upper bound distance restraints were 2.85, 3.56 and 5.00 A, respectively. Torsion angle restraints were obtained from secondary chemical shifts of the 1 H˛ , 13 C˛ , and 13 Cˇ nuclei with the program TALOS.21 The average values of the 10 best database matches were used as dihedral angle restraints and the corresponding standard deviations were used as upper and lower bounds. The structures were calculated using X-PLOR 3.851.22 Initially a series of substructures were generated using the DG-SUB-EMBED protocol. Hydrogen bonds in the helical region were included only in this calculation. Subsequently distance geometry simulated annealing calculations and refinement by restrained energy minimization were carried out as described previously.23 The force constants of the ˚ 2 and NOE and dihedral angle terms were 50 kcal mol1 A 1 2 200 kcal mol rad , respectively. RESULTS AND DISCUSSION Initial folding of GLP-1 in TFE Essential complete sequential assignments were accomplished for the proton resonances of GLP-1 at different TFE concentrations. Figure 1(a), (b) and (c) show the amide proton regions of the NOESY spectra of GLP-1 in pure water and in water with 20 and 35% TFE, respectively. As shown in Fig. 1, there is a clear correlation between the NOE pattern and the TFE concentration. In pure water solution only a small number of NOEs are observed, indicating a random coil conformation, whereas a large number of new NOEs appear as the amount of TFE is increased, indicating the formation of an increasing amount of secondary structure. No further changes were observed in the spectra at TFE concentrations higher than 35%. The 13 C˛ and 13 Cˇ nuclei were assigned for GLP-1 in 35% TFE, using a 1 H– 13 C HSQC spectrum obtained with 13 C in natural abundance. The sequential and medium-range NOEs observed for the GLP-1 in pure water and in the presence of 20 and 35% TFE are summarized in Fig. 2(a)–(c), together with the 1 ˛ H and 13 C˛ chemical shift indices24 (CSIs), and the slowly exchanging amide protons. Primarily, the medium-range NOEs in Fig. 2(c) indicate that a helical region ranging from T7 to K28 is formed in 35% TFE, although the number of NOEs connecting G16 to the rest of the helix is relatively small. Second, the medium-range NOEs observed in 20% TFE [Fig. 2(b)] show that the TFE-induced helix formation starts at the C-terminal end of the peptide. Both of these observations are supported by the 1 H˛ CSIs in Fig. 2(a)–(c). It should be noted that, in general, the change of the chemical shifts of the CH protons upon addition of TFE is negligible,25 so that the CSIs observed here in the presence of TFE reflect the formation of secondary structures in the same way as in pure water. The helix formation is further Magn. Reson. Chem. 2001; 39: 477–483 Structure and folding of GLP-1 in TFE Figure 1. Amide proton region of the 1 H NOESY spectrum of GLP-1 in aqueous TFE (1.4 mM, pH 2.5, 300 K) with different H2 O/TFE ratios (v/v), showing the correlation between the amide and aliphatic protons. (a) Pure water; (b) 20% TFE; (c) 35% TFE. supported by the NH exchange rates. Thus, in pure water all the amide protons are fast exchanging, in agreement with the disordered structure of GLP-1 indicated by the NOEs and CSIs. In contrast, 12 slowly exchanging amide protons were observed in 35% TFE, all of which are located within the helix and, predominantly, in the C-terminal part. A quantitative determination of the amide proton exchange rates, kobs , of nine of the 12 slowly exchanging amide protons (Table 1) indicates a relatively loose helix. The rates were determined from the linewidths of the NH correlated signals in a 2D NOESY spectrum in D2 O.18 For S11, S12 and Y13 a reliable, quantitative determination of the NH exchange rates was not possible because of severe signal overlap. A comparison of the experimental and the intrinsic exchange rates, kint , determined by the side-chains Copyright 2001 John Wiley & Sons, Ltd. of the adjacent amino acids,26 shows that the reduction of the experimental exchange rates reflects a genuine protection associated with ˛-helix formation. However, the size of the calculated protection factors (Table 1) indicates that the hydrogen bonding is relatively weak. Accordingly the exchange rates are larger than 0.35 h1 (Table 1), resulting in a complete exchange of all the NH protons within 12 h. This was confirmed by the absence of all NH correlations in a NOESY spectrum recorded 12 h after the dissolution of the sample in D2 O. More importantly, the NH exchange rates (Table 1) show that the C-terminal end of the helical region is more stable than the N-terminal end of the region. Thus seven of the 12 residues of the C-terminal helical region are slow exchanging whereas only five of the 11 residues in the N-terminal helical region are slow exchanging [Fig. 2(c)]. Magn. Reson. Chem. 2001; 39: 477–483 479 480 X. Chang et al. (a) 5 GLP-1: dα N: dNN: dβ N: dα N(i, i + 2): dα N(i, i + 3): dα N(i, i + 4): dαβ (i, i + 3): 10 15 20 25 30 H A E G T F T S D V S S Y L E G Q A A K E F I A W L V K G R CSI 1H: (b) GLP-1: dα N: dNN: dβ N: dα N(i, i + 2): dα N(i, i + 3): dα N(i, i + 4): dαβ (i, i + 3): H A E G T F T S D V S S Y L E G Q A A K E F I A W L V K G R CSI 1H: (c) GLP-1: Exchange: dα N: dNN: dβN: dα N(i, i + 2): dα N(i, i + 3): dα N(i, i + 4): d αβ (i, i + 3): H A E G T F T S D V S S Y L E G Q A A K E F I A W L V K G R CSI 1H: CSI 13C: Figure 2. Summary of sequential and medium-range NOE connectivities, and schematic representation of the 1 H˛ and 13 C˛ CSIs of GLP-1 in H2 O (1.4 mM, pH 2.5, 300 K) with different H2 O/TFE ratios (v/v). (a) Pure water; (b) 20% TFE; (c) 35% TFE. The observed NOEs are indicated by bars connecting the two involved residues, and the intensities of the NOEs are indicated by the thickness of the bars. The CSIs were calculated according to Wishart et al.24 Slowly exchanging backbone amide protons are indicated in (c) by filled circles. This difference in stability is further supported by the observed protection factors (Table 1). A similar observation of a more stable C-terminal region was made for GLP-16 and for glucagon27 in the presence of a dodecylphosphocholine micelle. In both cases the higher stability of the C-terminal region was attributed to the interaction with the micelle. However, the observation made here in the absence of a micelle suggests that other factors must contribute to the higher stability of the C-terminal helical region. One of these factors could be the larger number of hydrophobic Copyright 2001 John Wiley & Sons, Ltd. residues in the C-terminal region, which increases the ˛-helix propensity of the region. It should also be noted that the correlation between the higher stability of the C-terminal segment indicated by the NH exchange rates and the order of appearance of the NOEs and CSIs with increasing TFE concentration support the general view28,29 that the slowexchange core is the folding core, that is, the segment of a protein that is the most rigid in the folded state is also the segment that collapses early during the folding process. Magn. Reson. Chem. 2001; 39: 477–483 Structure and folding of GLP-1 in TFE Table 1. Exchange rates for slowly exchanging amide protons in the GLP-1 monomer in D2 O with 35% TFE NH Correlated to 1 2 Leu L14 ˇ ,exch (Hz) 1 (Hz) kobs (h1 )a kint (h1 )b Pc 2 CH2 (L14) CH(L14) 121.0 š 12.0 110.0 š 10.0 29.0 š 1.8 16.0 š 1.7 0.62 š 0.08 0.63 š 0.07 2.92 2.92 4.6 4.6 Glu E15 ˛ CH(E15) 115.0 š 16.0 19.7 š 1.1 0.64 š 0.11 7.40 11.6 Phe F22 ˇ CH2 (F22) 108.0 š 10.0 16.2 š 1.6 0.62 š 0.07 8.62 13.9 Ile I23 ˛ CH(I23) CH(I23) 70.0 š 6.0 70.0 š 8.0 15.9 š 1.5 15.0 š 0.8 0.36 š 0.04 0.37 š 0.05 1.60 1.60 4.5 4.5 ˇ Ala A24 ˛ CH(A24) 100.0 š 8.0 32.0 š 2.0 0.46 š 0.06 6.20 13.5 Trp W25 ˛ CH(W25) 68.5 š 5.0 16.3 š 1.1 0.35 š 0.03 7.23 20.7 Leu L26 ˛ CH(L26) 68.0 š 9.0 10.7 š 1.7 0.39 š 0.06 2.27 5.8 Val V27 ˛ CH(V27) 97.0 š 11.0 23.0 š 1.3 0.50 š 0.08 2.41 4.8 ˇ CH(L26) 94.0 š 9.0 21.6 š 1.0 0.49 š 0.06 2.41 4.9 ˛ CH(K28) 97.0 š 11.0 16.1 š 1.3 0.55 š 0.08 4.88 8.9 Lys K28 a Experimental exchange rates at 300 K and pH 2.5 (meter reading) including 1 standard deviations. The experimental rates were obtained from the linewidths of the NH cross peaks in a single NOESY spectrum recorded immediately after dissolution of the protonated GLP-1 in D2 O.18 The individual amide protons and is the linewidth in the F1 dimension of their correlation partners are listed in the first two columns. 1 2 ,exch the cross peak below the diagonal and 1 is the linewidth in the F2 dimension of the symmetric cross peak 2 above the diagonal. b Intrinsic exchange rates in the random coil peptide calculated according to Bai et al.26 c Protection factor P D kint /kobs . Structure of GLP-1 in 35% TFE Sixty structures were calculated from 280 NOEs, including 144 intra-residue, 84 sequential and 52 inter-residue sidechain NOEs, and 22 and 22 angle constraints, derived from the secondary 1 H˛ , 13 C˛ and 13 Cˇ chemical shifts using the program TALOS. Also 12 ˛-helix hydrogen bonds, assigned on the basis of the slowly exchanging amide protons and the NOE patterns observed for the GLP-1 monomer in 35% TFE, were included in the initial structure calculation as described above. The 20 best structures with the lowest total energies were chosen for further analysis. The best-fit superposition of the backbone of the 20 structures is shown in Fig. 3(a) and the structural statistics are given in Table 2. ˚ and no dihedral angle No NOE violations larger than 0.2 A violations larger than 5° were observed in any of the 20 structures. Table 2 indicates that the inclusion of the TALOS derived dihedral angles in the structure calculation improves the quality of the structure significantly. The correlation between the and angles of the calculated structures and the corresponding angles estimated with TALOS is shown in Fig. 4. The structures obtained show that GLP-1 in water with 35% TFE is predominantly helical, with a regular ˛-helix in most of the region from T7 to K28. Only the first six and the last two residues are disordered. However, the helix is less well-defined in a region around G16. This is supported by the chemical shift of the G16 1 H˛ that remains unchanged at the random coil value at all TFE concentrations. In contrast, the 13 C˛ resonance of G16 is shifted downfield, in agreement with a helix conformation. A similar less well-defined region Copyright 2001 John Wiley & Sons, Ltd. (a) N C (b) N C (c) N C Figure 3. Best-fit superposition of the 20 selected solution structures of the GLP-1 monomer; only the C0 , C˛ , and N backbone atoms are shown. (a) Residues 7–28 (the entire helical segment); (b) residues 7–15 (N-terminal helical region); (c) residues 18–28 (C-terminal helical segment). Magn. Reson. Chem. 2001; 39: 477–483 481 482 X. Chang et al. Table 2. Structural statistics for the GLP-1 monomer in H2 O with 35% TFE −45 −50 Number of constraints: Total number of NOEs Intra-residue NOEs Sequential NOEs Inter-residue NOEs Dihedral angles Hydrogen bonds 280 144 84 52 44 12 −55 −60 φ −65 −70 R.m.s.d. from NOE restraints and from the idealized geometry used within X-PLOR: ˚ NOE (A) Dihedral angles (° ) ˚ Bond lengths (A) ° Bond angles ( ) Improper dihedral angles (° ) 0.012 š 0.003 1.06 š 0.38 0.0054 š 0.0002 0.44 š 0.04 0.43 š 0.04 −80 PROCHECK36 Ramachandran analysis: Most favoured regions (%) Additional allowed regions (%) Generously allowed regions (%) Disallowed regions (%) 89.0 (58)a 6.6 (33)a 2.6 (5)a 1.8 (4)a −20 Average r.m.s.d. of the final ensemble: ˚ Backbone atoms (7–15) (A) ˚ Backbone atoms (18–28) (A) ˚ All backbone atoms (A) ˚ All heavy atoms (A) 0.49 (0.79)a 0.44 (0.99)a 2.55 (2.92)a 3.25 (3.94)a −75 a Numbers in parentheses correspond to structures calculated without the TALOS-derived dihedral angle restraints. around G16 was also suggested in the structure of the micellebound GLP-1.6 The two regular helical segments from T7 to E15 [Fig. 3(b)] and from A18 to K28 [Fig. 3(c)] are both well ˚ for the backbone, defined with r.m.s.d. of 0.49 and 0.44 A respectively. Since the number of NOE constraints that are observable for the side-chain atoms is relatively small, as normally found for small single-stranded peptides, the r.m.s.d. for the entire peptide is relatively high. Overall, the GLP-1 structure obtained is similar to that ˚ resolution crystal of micelle-bound GLP-16 and the 3 A 30 structure of glucagon (glucagon has a 50% sequence homology with GLP-1), although the low resolution of the last two structures prevents a detailed comparison. Two features of the structure obtained here are worth noting. First, the less well-defined structure around G16 indicates an increased flexibility around this position. A similar flexible region has been observed in other amphipathic helices31 – 33 and is presumably important for the function of the peptides. In the case of the free GLP-1 in solution, the flexibility around G16 undoubtedly contributes to the reported propensity of the peptide to form aggregates with different ˛-helix and ˇ-sheet conformations.3,4 In the case of the micelle-bound GLP-1 it was suggested6 that the flexible region allows the helix to assume a phase shift whereby the hydrophilic residues will be located on one side of the strand and the hydrophobic residues on the other side. This allows the helix to bind to the membrane with a larger hydrophobic face. The detailed structure including the flexible region around G16, Copyright 2001 John Wiley & Sons, Ltd. −85 10 15 20 25 Residue number −15 −25 −30 ψ −35 −40 −45 −50 −55 −60 10 15 20 25 Residue number Figure 4. Comparison of the and angles estimated with TALOS21 ž and the corresponding angles of the calculated structures . The error bars correspond to the uncertainties of the TALOS estimates and the variation of the calculated structures, respectively. Incorporation of TALOS angles as constraints in the structure calculations reduces the NOE violations and improves the quality of the structure significantly (see Table 2). that is found here for the free monomeric GLP-1, support this model for the binding of GLP-1 to its receptor. Second, the homology of GLP-1 and glucagon, and the fact that glucagon can replace receptor-bound GLP-1,34 prompt a comparison of the structures of the two peptides. A high flexibility of the N-terminal region (residues 1–4), as observed for GLP-1, was also found in the crystal structure of glucagon30 and may be relevant for the function of the two peptides. In both peptides this flexibility is most likely due to the presence of a glycine in position 4. The C-terminal fragment F22–V23–Q24–W25–L26 of glucagon, that was suggested to be essential for the binding of the hormone to its receptor,35 is partly preserved in GLP-1 as F22–I23–A24–W25–L26. Indeed, this fragment is part of the helix that binds to the membrane-like micelles.6 Therefore, the C-terminal helix of GLP-1 is not only the most stable part of the helix and the one that initiates the formation of Magn. Reson. Chem. 2001; 39: 477–483 Structure and folding of GLP-1 in TFE the helix in the folding pathway of the peptide chain (see above), but may also play an important role in the receptor recognition. CONCLUSION The results here show that the conformation of free monomeric GLP-1 in water–TFE mixtures at pH 2.5 depends strongly on the content of TFE. In pure water GLP-1 adopts predominantly a flexible random coil, whereas in water with 35% TFE it forms a single-strand ˛-helix. The helix extends from T7 to K28 with a less well-defined helical region around G16 that increases the flexibility of the helix. The C-terminal segment of the helix is formed first during the folding and is considerably more stable than the N-terminal segment. The propensity of free monomeric GLP-1 to form a helical structure and the presence of the flexible region around G16 are both in agreement with the structure suggested for the micelle-bound GLP-1, and support the model proposed for the receptor binding of GLP-1.6 Acknowledgements The 750 and 800 MHz NOESY and HSQC spectra were obtained at the Danish Instrument Centre for NMR Spectroscopy of Biological Macromolecules. We are grateful to Dr Jens Duus and Ms Else Philipp for technical assistance. The coordinates for the GLP-1 monomer structures at 35% TFE and the NMR-derived restraints have been deposited in the Protein Data Bank at RCSB (code: 1D0R). The 1 H chemical shifts of GLP-1 in aqueous TFE at nine different TFE concentrations in the range from 0 to 50% TFE and the 13 C chemical shifts of GLP-1 in 35% TFE have been deposited in the BioMagResBank (http://www.bmrb.wisc.edu) under BMRB accession number 4741. This work was financially supported by the Danish Technical Research Council (J. Nos 16-5028-1 and 9601137), the Danish Natural Science Research Council (J. Nos 9400351, 9502759, 9601648 and 9801801), the Ministry of Industry (J. No. 85886), Julie Damm’s Studiefond, Direktør Ib Henriksens Fond, Carlsbergfondet and Novo Nordisk Fonden. REFERENCES 1. Drucker DJ, Philippe J, Mosjov S, Chick WL, Habener JF. Proc. Natl. Acad. Sci. USA 1987; 84: 3434. 2. Adelhorst K, Hedegaard BB, Knudsen LB, Kirk O. J. Biol. Chem. 1994; 269: 6275. 3. Kim Y, Rose CA, Liu Y, Ozaki Y, Datta G, Tu AT. J. Pharm. Sci. 1994; 83: 1175. Copyright 2001 John Wiley & Sons, Ltd. 4. Senderoff RI, Kontor KM, Kreilgaard L, Chang JJ, Patel S, Krakover J, Heffernan JK, Snell LB, Rosenberg GB. J. Pharm. Sci. 1998; 87: 183. 5. Lambert WJ, Grucza RA, Stamper GF, Chrunyk B. Pharm. Res. 1994; 11: S-83. 6. Thornton K, Gorenstein DG. Biochemistry 1994; 33: 3532. 7. Buck M. Q. Rev. of Biophys. 1998; 31: 297. 8. Sonnichsen FD, Van Eyk JE, Hodges RS, Sykes BD. Biochemistry ¨ 1992; 31: 8790. 9. Hamada D, Kuroda Y, Tanaka T, Goto Y. Mol. Biol. 1995; 254: 737. 10. Jasanoff A, Fersht AR. Biochemistry. 1994; 33: 2129. 11. Rajan R, Balaram P. Int. J. Pept. Protein Res. 1996; 48: 328. 12. Kentsis A, Sosnick TR. Biochemistry 1998; 37: 14613. 13. Wuthrich K. NMR of Proteins and Nucleic Acids. John Wiley & ¨ Sons: New York, 1986. 14. Piantini U, Sørensen OW, Ernst RR. J. Am. Chem. Soc. 1982; 104: 6800. 15. Braunschweiler L, Ernst RR. J. Magn. Reson. 1983; 53: 521. 16. Jeener M, Meier BH, Bachman P, Ernst RR. J. Chem. Phys. 1979; 71: 4546. 17. Bodenhausen G, Reuben DJ. J. Chem. Phys. 1980; 69: 185. 18. Olsen HB, Gesmar H, Led JJ. J. Am. Chem. Soc. 1993; 115: 1456. 19. Gesmar H, Nielsen PF, Led JJ. J. Magn. Reson. B 1994; 103: 10. 20. Kristensen SM, Sørensen MD, Gesmar H, Led JJ. J. Magn. Reson. B 1996; 112: 193. 21. Cornilescu G, Delaglio F, Bax A. J. Biomol. NMR 1999; 13: 289. 22. Brunger AT. X-PLOR Manual. Yale University Press: New ¨ Haven, CT, 1992. 23. Jørgensen AMM, Olsen HB, Balschmidt P, Led JJ. J. Mol. Biol. 1996; 257: 684. 24. Wishart DS, Sykes BD, Richards FM. Biochemistry 1992; 31: 1647. 25. Merutka G, Dyson HJ, Wright P. J. Biomol. NMR 1995; 5: 14. 26. Bai Y, Milne JS, Mayne L, Englander SW. Proteins: Struct. Funct. Genet. 1993; 17: 75. 27. Wuthrich K, Billeter M, Braun W. J. Mol. Biol. 1983; 169: 949. ¨ 28. Yang JJ, Buck M, Pitkeathly M, Kotik M, Haynie DT, Dobson CM, Radford SE. J. Mol. Biol. 1995; 252: 483. 29. Kim KS, Fuchs JA, Woodward C. Biochemistry 1997; 36: 3383. 30. Sasaki K, Dockerill S, Adamiak DA, Tickle IJ, Blundell T. Nature (London) 1975; 257: 751. 31. Barlow DJ, Thornton JM. J. Mol. Biol. 1988; 201: 601. 32. Zhou NE, Zhu BY, Sykes BD, Hodges RS. J. Am. Chem. Soc. 1992; 114: 4320. 33. McLeish M, Nielsen KJ, Najbar LV, Wade JD, Lin F, Doughty MB, Craik DJ. Biochemistry 1994; 33: 11174. 34. Thorens B. Proc. Natl. Acad. Sci. USA 1992; 89: 8641. 35. Rodbell M, Birnbaumer L, Pohl SL, Sundby F. Proc. Natl. Acad. Sci. USA 1971; 68: 909. 36. Laskowski RA, Rullmann JAC, MacArthur MW, Kaptein R, Thornton JM. J. Biomol. NMR 1996; 8: 477. Magn. Reson. Chem. 2001; 39: 477–483 483
© Copyright 2026 ExpyDoc