Proteomic Analysis of Acetaminophen Toxicity in 3D Human Liver Microtissues Claudia Escher , Reto Ossola , Patrina Gunness , Magdalena Bober , Fiona Grimm , Lukas Reiter , Yulia Butscheid , Simon Messner 1 Biognosys AG, Schlieren, Switzerland, www.biognosys.ch 2 InSphero AG, Schlieren, Switzerland, www.insphero.com 1 1 2 1 1 1 1 2 1890-262 Data-independent acquisition - Protein ID 1 Protein name Peptide 20 40 60 80 100 Retention time [min] 120 Upregulated Oxidation reduction (1) Drug metabolic process (2) Mitochondrial transport (3) Xenobiotic metabolic process (5) Downregulated Response to calcium ion (1) Response to inorganic substance (2) Response to metal ion (3) Fatty acid metabolic process (4) Leukotriene metabolic process (6) / Icosanoid metabolic process (16) Response to wounding (14) / Acute inflammatory response (22) Replicate 1 Replicate 2 Mass spectrometric raw data show a drastic induction of CYP1A2 already at subtoxic concentrations of acetaminophen. No effect on cell viability is detectable at these levels. Donor I 0.9 Donor II 0.8 0.7 0.6 10 100 1000 10000 Acetaminophen concentration [uM] 1 3 2.5 2 Donor I Donor II 1 0.5 10 100 1000 10000 Acetaminophen concentration [uM] 1.8 1.6 1.4 Donor I 1.2 Donor II 1 0.8 1 10 100 1000 10000 Acetaminophen concentration [uM] 1.4 1.3 1.2 1.1 1 Donor I 0.9 Donor II 0.8 0.7 0.6 1 4 3.5 3 Donor I 2 Donor II 1.5 1 0.5 1 10 100 1000 10000 Acetaminophen concentration [uM] 10 100 1000 10000 Acetaminophen concentration [uM] Cytochrome P450 1A2 (UniProt P05177) 4.5 2.5 10 100 1000 10000 Acetaminophen concentration [uM] Bile salt sulfotransferase (UniProt Q06520) CYP3A5 (UniProt P20815) CYP2E1 (UniProt P05181) 1.5 Fold-change vs. Control Sample Fold-change vs. Control Sample Fold-change vs. Control Sample 1 Gluronoyltransferases are upregulated in 3D Liver Microtissues from both donors with increasing acetaminophen concentration (above). The bile salt sulfotransferase (right) shows a donor II-specific upregulation. In contrast, a donor-specific upregulation is seen for cytochrome P450 2E1 in donor I (below). These observations might explain the higher acetaminophen toxicity observed in donor I as more of the toxic NAPQI metabolite might be produced. 1 Replicate 3 1.1 Fold-change vs. Control Sample 1103.02 3309.07 10 56 1.2 Fold-change vs. Control Sample 367.67 3 Unbiased global discovery approach reveals early upregulation of CYP1A2 protein O75608 Acyl-protein thioesterase 1 TYEGMMHSSCQQEMMDVK 731.29103 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial LSGTEAHVLGLVNHAVAQNEEGDAAYQR 738.11669 P30711 Glutathione S-transferase theta-1 VEAAVGEDLFQEAHEVILK 699.70027 P55157 Microsomal triglyceride transfer protein large subunit EFYSYQNEAVAIENIKR 692.01285 Q99733 Nucleosome assembly protein 1-like 4 LDNVPHTPSSYIETLPK 637.66679 P53621 Coatomer subunit alpha GVNWAAFHPTMPLIVSGADDR 752.04063 Q9UL12 Sarcosine dehydrogenase, mitochondrial HWHADLRPDDSPLEAGLAFTCK 634.8064 P21397 Amine oxidase [flavin-containing] A EIPTDAPWEAQHADKWDK 713.00435 Q15149 Plectin DALDGPAAEAEPEHSFDGLR 699.6555 Q00796 Sorbitol dehydrogenase MHSVGICGSDVHYWEYGR 718.31577 P80404 4-aminobutyrate aminotransferase, mitochondrial MLDLYSQISSVPIGYSHPALLK 811.43465 P30153 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit IGPILDNSTLQSEVKPILEK 732.08249 P23378 Glycine dehydrogenase [decarboxylating], mitochondrial IQPVEVDKYGNIDAVHLK 510.27965 P19338 Nucleolin VEGTEPTTAFNLFVGNLNFNK 1156.5815 P30048 Thioredoxin-dependent peroxide reductase, mitochondrial AFQYVETHGEVCPANWTPDSPTIKPSPAASK 847.1594 Q9NQ94 APOBEC1 complementation factor NNWGQPVYQLHSAIGQDQR 737.69451 Q13907 Isopentenyl-diphosphate Delta-isomerase 1 ITFPGCFTNTCCSHPLSNPAELEESDALGVR 1160.527 P05089 Arginase-1 RPIHLSFDVDGLDPSFTPATGTPVVGGLTYR 822.17802 P00439 Phenylalanine-4-hydroxylase THACYEYNHIFPLLEK 678.99625 Q9H3P7 Golgi resident protein GCP60 GPGASGEQPEPGEAAAGGAAEEAR 1083.4883 P00966 Argininosuccinate synthase FAELVYTGFWHSPECEFVR 792.03689 2 Retrospective data analysis Upregulated Protein Cytochrome P450 1A2 Sulfiredoxin-1 Cytochrome P450 2C8 Cytochrome P450 4F3 0 122.56 3 Donor II 1.3 2 14 12 10 8 6 Donor I 4 Donor II 2 0 1 10 100 1000 10000 Acetaminophen concentration [uM] Mass/Charge Q86YB7 Data-independent acquisition 40.85 1 Donor I 1.4 Proteins with highest regulation in liver microtissues upon acetaminophen treatment Peptide spectral library Relative intensity HRM-MS™ technology HRM-MS is a novel mass spectrometric approach for global proteome profiling and biomarker discovery. Data-independent acquisition (DIA) allows the measurement of all detectable peptide signals in a given sample e.g. over a treatment range. Subsequent matching with a previously generated peptide spectral library enables reproducible and accurate quantification of thousands of proteins in a single instrument measurement. Thus, HRM-MS™ combines the scale of shotgun mass spectrometry with the analytical accuracy of targeted proteomics especially when protein quantification across multiple samples is required. 13.62 2 UDP-glucuronosyltransferase 2B15 (UniProt P54855) UDP-glucuronosyltransferase 1-6 (UniProt P19224) Fold-change vs. Control Sample Donor-specific sensitivity to acetaminophen Intracellular measurement of ATP-content (CellTiter-Glo®, Promega) of 3D InSight™ Human Liver Microtissues after 72h exposure to ac50 etaminophen with daily medium renewal. Donor I shows an IC of 1093µM, donor II 2300µM. Error bars are standard deviation. 4.54 1 2.2 2 1.8 1.6 1.4 1.2 1 0.8 0.6 0.4 1 Fold-change vs. Control Sample CD68 (A) H&E-staining and (B) CD68-staining of formalin-fixed, paraffin embedded 3D InSight™ Human Liver Microtissues over 28 days in culture. H&E-staining indicates tight cell-cell contacts and intact liver-like morphology. Co-cultured CD68-positive Kupffer-cells integrate into Human Liver Microtissues and are present throughout the culture period. Concentration [uM] # regulated proteins Control Day 28 Significantly regulated proteins The numbers of significantly regulated proteins (p=0.05, two-fold change) increase with acetaminophen concentration. UDP-glucuronosyltransferase 1-1 (UniProt P22309) Enriched GO-terms in regulated proteins DAVID functional annotation reveals relevant cellular processes that are activated or deactivated upon acetaminophen exposure. Numbers in brackets are significance ranks. 9.77µM Day 21 phen concentration range 2361 proteins were relatively quantified compared to the baseline over the acetaminophen concentration range. Most proteins in 3D Human Liver Microtissues don’t show induced changes in protein expression and serve as baseline controls. 36.09µM Day 14 H&E Day 7 Targeted analysis of acetaminophen-relevant proteins Acetaminophen at subtoxic concentrations is mainly metabolized via conjugation with sulfate or glucuronide by sulfotransferases or glucuronosyltransferases. At high concentrations, these pathways become saturated and the highly reactive metabolite NAPQI is formed by cytochromes P450. Generation of thousands of protein profiles over acetamino- Concentration Experimental summary 3D Human Liver Microtissues from two independent primary human hepatocyte lots (lot IZT (donor I); S1195T (donor II) were co-cultured with Kupffer cells (lot ZAR) and were exposed to 8 subtoxic concentrations of acetaminophen (4 µM - 3,310 µM) for 72 hours. Proteins from microtissues were extracted and subjected to mass spectrometric analysis. Global proteome profiles were generated using a library of over 2400 proteins. Treatment-dependent changes in protein expression were determined by performing pairwise t-test comparisons of each acetaminophen concentration with an untreated control. Introduction Early prediction of drug safety remains a challenge in preclinical phases of drug development. Global proteomic analysis allows for a better understanding of the mode of action and mechanism of toxicity induced by drug treatment. We applied a novel mass-spectrometric approach - Hyper Reaction Monitoring (HRM) – to quantify changes in protein expression in 3D InSight™ Human Liver Microtissues exposed to acetaminophen. Gene Name CYP1A2 SRXN1 CYP2C8 CYP4F3 Downregulated FoldChange (Donor I/Donor II) Function Protein 4.5/10 NADPH-dependent electron transport, aflatoxin B1 and acetaminophen metabolism Fibrinogen alpha chain 4.8/5.1 2.6/2.3 3.0/2.3 Gene Name FGA FN1 FoldChange (Donor I/Donor II) Function -2.1/-2.8 Fibrin deposition / cofactor in platelet aggregation (in blood) -2.0/-2.2 Cell adhesion, cell motility, wound healing Oxidative stress resistance Fibronectin NADPH-dependent electron transport, taxol metabolism Hydroxymethylglutaryl-CoA synthase, cytoplasmic HMGCS1 -4.5/-4.8 Intermediate biosynthesis, involved in liver development Monooxygenase Peroxisomal acyl-coenzyme A oxidase 1 ACOX1 -2.8/-2.8 Fatty acid metabolism Conclusions • Minimal sample quantity is required for large-scale proteomic study (12’000 cells/sample) • Protein profiles across 48 samples from two donors were generated containing a total of more than 113,000 individual protein quantifications • Identification of relevant proteins in acetaminophen metabolism (unbiased discovery approach) • Targeted analysis of known proteins of interest allows for specific pathway analysis and reveals donor-specific expression patterns • Global protein profiling using the novel mass spectrometric HRM approach enables quantifica- tion of thousands of proteins over many states (treatments, time points, concentrations, etc.)
© Copyright 2026 ExpyDoc