AB STRAC T B O O K www.eswiconference.org TA B L E OF CON TE N TS L E C TU R E A BSTRAC TS TAB LE OF CO NTENTS TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA II TA B L E OF CON TE N TS L E C TU R E A BSTRAC TS LECTURE ABSTRACTS SPB103 SPA1: CLINICAL IMPACT AND DIAGNOSTIC APPROACHES Assembly of Influenza virus particles: Signals for targeting of HA and M2 to the budding site L2 SPA101 Ability of the Luminex xTAG RVP to detect zoonotic influenza viruses with pandemic potential Veit, Michael (1); Brett, Katharina (1); Kordyukova, Larisa (2); Serebryakova, Marina (2); Siche, Stefanie (1); Thaa, Bastian (1); deVries, Maren (1); Herrmann, Andreas (3) SPB104 L9 Conserved and host-specific features of influenza virion architecture Jörn Winter, Christine Warnes and Stephen Lindstrom SPA102 L8 L3 Hutchinson, Edward; Charles, Philip; Hester, Svenja; Thomas, Benjamin; Trudgian, David; Martínez-Alonso, Mónica; Fodor, Ervin L4 SPA2: EPIDEMICS AND PANDEMIC THREATS A review of the link between influenza and non-communicable diseases Palache, Abraham Mozes (1); Tainijoki-Seyer, Dr. Julia (2) SPA103 Influenza B disease burden in general population in France. Results of the IBVD retrospective study from 2003 to 2014 SPA201 The Epidemiological Characteristics of Influenza B Compared to Influenza A: Results of the Global Influenza B Study Cohen, Jean Marie (1,2); Daviaud, Isabelle (1,2); Debost, Emmanuel (2); Valette, Martine (3); Enouf, Vincent (4); Mosnier, Anne (1,2) L5 SPA104 Severity related factors in patients with severe acute respiratory infections (SARI): results from the Belgium SARI surveillance during the Influenza season 2012-2013 Caini, Saverio (1); Huang, Sue (2); Ciblak, Meral Akçay (3); Schellevis, François (1); Plotkin, Stanley (4); Paget, John (1) SPA202 Gefenaite, Giedre (1); Caini, Saverio (2); Gross, Diane (3); Meerhoff, Tamara (4); Pereyaslov, Dmitriy (3); Paget, John (2); Brown, Caroline Sarah (3) SPA203 L6 The novel functional site in the PB2 subunit of RNA-dependent RNA polymerase essential for acetyl-CoA interaction, RNA polymerase activity and viral replication Wu, P (1); Jiang, H (2); Wu, JT (1); Chen, E (3); He, J (4); Zhou, H (2); Wei, L (1); Yang, J (2); Yang, B (1); Qin, Y (2); Fang, VJ (1); Li, M (2); Tsang, TK (1); Zheng, J (2); Lau, EHY (1); Cao, Y (2); Chai, C (3); Zhong, H (4); Li, Z (2); Leung, GM (1); Feng, L (2); Gao, GF (5,6); Cowling, BJ (1); Yu, H (2) SPA204 Hatakeyama, Dai (1); Shoji, Masaki (1); Yamayoshi, Seiya (2); Hirota, Takenori (1); Nagae, Monami (1); Yanagisawa, Shin (1); Kawaoka, Yoshihiro (2); Kuzuhara, Takashi (1) L14 Molecular determinants of influenza A/H7N9 virus HA receptor binding and stability L7 Role of segment-specific genome packaging signals in genetic reassortment of influenza A viruses L13 Effectiveness of closure of live poultry markets in reducing influenza A(H7N9) transmission during the 2013-14 winter wave SPB1: VIRUS STRUCTURE AND REPLICATION SPB102 L11 Seasonal influenza in the WHO European Region: analysis of 2008-2013 influenza surveillance data in 48 countries Nathalie Bossuyt (1), Anneleen Hombrouck (2), Isabelle Thomas (2), Françoise Wuillaume (1), Viviane Van Casteren (1), Steven Van Gucht (2) , the Belgian Network of sentinel general practitioners, the Belgian Network of sentinel hospitals, Sophie Quoilin (1) SPB101 L10 Schrauwen, Eefje J.A. (1); Richard, Mathilde (1); Herfst, Sander (1); Bestebroer, Theo (1); Lexmond, Pascal (1); Burke, David F. (2); Rimmelzwaan, Guus F. (1); Osterhaus, Albert D.M.E. (1); Fouchier, Ron A.M. (1) Isel, Catherine (1); Essere, Boris (2); Yver, Matthieu (2); Gavazzi, Cyrille (1); Terrier, Olivier (2); Fournier, Emilie (1); Giroux, Fabienne (2); Textoris, Julien (3); Julien, Thomas (2,4); Socratous, Clio (2); Rosa-Calatrava, Manuel (2,4); Lina, Bruno (2,5); Marquet, Roland (1); Moulès, Vincent (2,4) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA III TA B L E OF CON TE N TS L E C TU R E A BSTRAC TS SPA304 SPB2: VIRAL FACTORS IN PATHOGENESIS SPB201 L15 Human cytotoxic T lymphocytes directed to influenza B viruses cross-react with viruses of two phylogenetic lineages L16 SPB3: MATHEMATICAL MODELING The Epidemiological Characteristics of Influenza B Compared to Influenza A: Results of the Global Influenza B Study L23 Van De Sandt, Carolien E.; Dou, Yingying; Vogelzangvan Trierum, Stella E.; Westgeest, Kim B.; Osterhaus, Albert D.M.E.; Fouchier, Ron A.M.; Hillaire, Marine L.B.; Rimmelzwaan, Guus F. Baumann, Jan; Monougu, Nancy; Klenk, Hans Dieter; Matrosovich, Mikhail SPB202 Single cell analysis reveals strain-specific inhibition of ISG-expression by the viral NS1 protein in influenza A virus infected cells SPB301 von Recum, Jessica; Weinheimer, Viola K; Wolff, Thorsten L17 SPB203 Neuraminidase-negative avian influenza viruses of subtype H5 and H7: Variation of virulence in the chicken model L19 SPB204 Reperant, Leslie (1); Kuiken, Thijs (1); Grenfell, Bryan (2); Osterhaus, Albert (1) SPB302 Hoffmann, Donata (1); Röhrs, Susanne (1); Bogs, Jessica (1); Stech, Jürgen (2); Beer, Martin (1) Assessment of transmission, pathogenesis and adaptation of H2 subtype influenza viruses using the ferret model Markovic Delabre, Rosemary (1,2); Salez, Nicolas (3); Lemaitre, Magali (4); Leruez-Ville, Marianne (5,6); de Lamballerie, Xavier (3,7,8); Carrat, Fabrice (1,2,9) SPB303 SPA3: IMMUNOLOGY Wu, Joseph (1); Leung, Kathy (1); Perera, Ranawaka APM (1); Chu, Daniel KW (1); Lee, Cheuk Kwong (2); Hung, Ivan FN (3); Lin, Che Kit (2); Lo, Su-Vui (4); Lau, Yu-Lung (5); Leung, Gabriel M (1); Cowling, Benjamin J (1); Peiris, JS Malik (1) CD8+ T cells correlate with protection against symptomatic illness following natural pandemic influenza infection in humans SPA4: ANTIVIRALS AND RESISTANCE L21 SPA401 L30 Influenza A(H7N9) virus gains neuraminidase inhibitor resistance without loss of in vivo virulence or transmissibility Krammer, Florian Polyclonal and Isotype-Specific Effects of Hemagglutinin Stalk-Mediated Neutralization L29 Miller, Mark Andrew; Collaborating Team, MISMS Exploring the humoral cross-reactome against the influenza virus surface glycoproteins proteins hemagglutinin and neuraminidase SPA303 SPB304 The MISMS program: highlights of an international influenza research network Sridhar, Saranya (1); Begom, Shaima (1); Bermingham, Alison (2); Hoschler, Katja (2); Adamson, Walt (3); Carman, William (3); Bean, Thomas (4); Barclay, Wendy (1); Deeks, Jonathan (5); Lalvani, Ajit (1) SPA302 L28 Inferring Influenza Infection Attack Rate from Seroprevalence Data L20 L26 Seroprotection threshold and persistence of seroprotective titer among 2007H1N1 infected subjects: results from the Flurec cohort study Claudia Pappas, Hua Yang, Hui Zeng, Paul J. Carney, James Stevens, Jacqueline M. Katz, and Terrence M. Tumpey. SPA301 L24 The immune response and within-host emergence of pandemic influenza virus L22 Hai, Rong (1); Schmolke, Mirco (1,2); Leyva-Grado, Victor H. (1); Thangavel, Rajagowthamee R. (1); Margine, Irina (1); Jaffe, Eric L. (1); Krammer, Florian (1); Solórzano, Alicia (4); García-Sastre, Adolfo (1,2,3); Palese, Peter (1,3); Bouvier, Nicole M. (1,3) Miller, Matthew S. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA IV TA B L E OF CON TE N TS L E C TU R E A BSTRAC TS L31 SPA402 L38 SPB404 Influenza antiviral susceptibility monitoring in Europe – taking stock of 10 years’ experience, 2004-2014 Isolation of H15N7 influenza virus from wild birds in Eastern Europe and its relationship to viruses from other regions Meijer, Adam (1,10); Lackenby, Angie (2,10); Pereyaslov, Dmitriy (3); Enouf, Vincent (4,10); Kossyvakis, Athanasios (5,10); Lina, Bruno (6,10); Rebelo-de-Andrade, Helena (7,10); Pozo Sánchez, Francisco (8,10); Hay, Alan (9); McCauley, John (9); Daniels, Rod (9); Zambon, Maria (2) Muzyka, Denys (1); Fereidouni, Sasan (3) L33 SPA403 Evidence for clinical efficiency potential of anti-H5N1 polyclonal immunoglobulins Fabenflu® L34 Takashita, Emi (1); Ejima, Miho (1); Fujisaki, Seiichiro (1); Yokoyama, Masaru (2); Nakamura, Kazuya (1); Shirakura, Masayuki (1); Sugawara, Hiromi (1); Sato, Aya (1); Sato, Hironori (2); Tashiro, Masato (1); Odagiri, Takato (1) SPA5: VACCINES: CURRENT AND NOVEL APPROACHES L35 de Vries, Rory Dylan (1); Kreijtz, Joost (1); Sutter, Gerd (2); Osterhaus, Albert (1); Rimmelzwaan, Guus (1) SPA503 SPA504 L36 European surveillance network for influenza in pigs (ESNIP): Surveillance programs, diagnostic tools and swine influenza viruses identified in 14 European countries from 2010 to 2013 L42 Evaluation of heterosubtypic immune responses in older people following prepandemic H5N1 influenza vaccination M Levine (1)*, K Nicholson (2), S Batham (2), D Wang (1), B Dighero-Kemp (1), ZN Li1, V Veguilla (1), F Liu1, XH Lu (1), J Katz (1). Simon, Gaëlle (1); Larsen, Lars E (2); Dürwald, Ralf (3); Foni, Emanuela (4); Van Reeth, Kristien (5); Reid, Scott M (6); Harder, Timm (7); Dan, Adam (8); Markowska-Daniel, Iwona (9); Maldonado Garcia, Jaime (10); Huovilainen, Anita (11); Billinis, Charalambos (12); Davidson, Irit (13); Agüero Garcia, Montserrat (14); Bublot, Michel (15); Brown, Ian H (6); Loeffen, Willie (16) SPB5: GENETICS AND EVOLUTION OF VIRUS AND HOST L37 Pathobiology of novel genotype of H9N2 containing polymerase (PB2, PB1, PA) and non-structural (NS) gene segments derived from high pathogenicity H7N3 avian influenza virus L41 Specific induction of neutralizing antibodies against HA, and T cell responses against conserved influenza antigens Grødeland, Gunnveig (1); Mjaaland, Siri (2); Baranowska, Marta (1); Fredriksen, Agnete (1); Bogen, Bjarne (1) Gildea, Sarah; Cullinane, Ann SPB403 L40 Mva-based influenza vaccines – bringing these viral vectors from bench to bedside Equine Influenza virus surveillance in Ireland – findings of international significance SPB402 L39 Florek, Nicholas W. (1,2); Weinfurter, Jason T. (1,2); Jegaskanda, Sinthujan (3); Brewoo, Joseph N. (4); Powell, Tim D. (4); Young, Ginger R. (4); Das, Subash C. (4); Hatta, Masato (1); Broman, Karl W. (1); Hungnes, Olav (5); Dudman, Susanne G. (5); Kawaoka, Yoshihiro (1); Kent, Stephen J. (3); Stinchcomb, Dan T. (4); Osorio, Jorge E. (1,4); Friedrich, Thomas C. (1,2) SPA502 SPB4: ANIMAL FLU-ECOLOGY AND EPIDEMIOLOGY OF ANIMAL INFLUENZA (2); Modified vaccinia Ankara encoding influenza hemagglutinin induces heterosubtypic immunity in macaques A community cluster of influenza A(H1N1) pdm09 virus exhibiting cross-resistance to oseltamivir and peramivir in Japan, November 2013 to February 2014 SPB401 Mary SPA501 Herbreteau, Cécile Hélène (1); Buchy, Philippe (2); Bal, Céline (1); Durand, Caroline (1); Tambyah, Paul (3); Lépine, Bertrand (1) SPA404 Pantin-Jackwood, SPB501 L43 Two independent evolutionary pathways of HPAIV Stech, Olga; Veits, Jutta; Abdelwhab, Sayed; Wessels, Ute; Mettenleiter, Thomas C.; Stech, Juergen Iqbal, Munir (1); Yaqub, Tahir (2); Mukhtar, Nadia (2); Shabbir, Muhammad Z (2); McCauley, John W (3) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA V TA B L E OF CON TE N TS L E C TU R E A BSTRAC TS L44 SPB502 Dynamics of influenza virus reassortment in a co-infected host Tao, Hui; Steel, John; Lowen, Anice Mapping the antigenic drift of human influenza A(H1N1) and B viruses since the 1940s Risk factors for severe outcomes and impact of vaccination on pneumonia and influenza within active US military populations 20002012 Van Kerkhove, Maria D (1); Cooper, Michael J (2); ErikCost, Angelia A (2); Sanchez, Jose L (2); Riley, Steven (1) Koel, Björn L46 High co-infection rates and multiplicity reactivation facilitate incomplete gene segment packaging in vivo Huang, Q. Sue (1); Turner, N. (2); Baker, MG (3); McArthur, C (4); Williamson, D (1,2,4); Grant, C (2); Roberts, S (4); Aley, D (4); Trenholme, A (5); Conroy, C (5); Taylor, S (5); Lawrence, S (5); Davey, K (5); Wood, T (1); Bissielo, A (1); Radke, S (1); Bandaranayake, D (1); Seeds, R (1); Mackereth, G (1); Todd, A (1); Pierse, N (3); Thomas, P (6); Webby, R (6); Thompson, M (7); Duque, J (7); Gross, D (7); Widdowson, MA (7) SPA6: EVALUATION OF VACCINE SAFETY AND EFFECTIVENESS L47 SPA601 Live attenuated vaccines against potentially pandemic influenza viruses: rationale for genetic stability Blak, Betina (1); Rajaram, Sankarasubramanian (1); Steffey, Amy (2); Caspard, Herve (2) L48 Mohn, Kristin G-I (1); Bredholt, Geir (1); Brokstad, Karl (1); Aarstad, Hans Jørgen (2); Pathirana, Rishi (1); Tøndel, Camilla (2); Cox, Rebecca Jane (1,2) L49 Brown, Caroline Michala Sarah; Hegermann-Lindencrone, SPA701 L55 Flu vaccination of pregnant women in Kazakhstan Kuatbayeva, Ainagul Mukhanovna Cowling, Benjamin; Chan, Kwok-Hung; Feng, Shuo; Chan, Eunice; Peiris, Malik; Chiu, Susan SPA702 L50 Influenza revaccination with MF59®adjuvanted or nonadjuvanted trivalent inactivated seasonal influenza vaccines in 30–96 month-old children primed two years previously Pandemic preparedness in Europe – five years on from the 2009 pandemic SPA7: MATERNAL IMMUNIZATION Effectiveness of influenza vaccination in preventing hospitalizations in children in Hong Kong, 2009-13 SPA604 L54 SPB604 Cellular immune responses elicited after intranasal influenza vaccination in children, a clinical trial SPA603 L53 SPB603 Extension of the United Kingdom Influenza Immunisation Programme 2013/2014 to Children and the Implications for High-Risk Group Uptake Kiseleva, Irina (1); Larionova, Natalie (1); Dubrovina, Irina (1); Bazhenova, Ekaterina (1); Fedorova, Ekaterina (1); Isakova-Sivak, Irina (1); Kuznetsova, Victoria (1); Stukova, Marina (2); Erofeeva, Marianna (2); Pisareva, Maria (2); Desheva, Julia (1); de Jong, Jorgen (3); Ross, Ted (4); Flores, Jorge (5); Tsvetnitsky, Vadim (5); Rudenko, Larisa (1) L52 SPB602 Southern hemisphere influenza and vaccine effectiveness research and surveillance (SHIVERS) in New Zealand Brooke, Christopher Byron SPA602 L51 SPB601 L45 SPB503 SPB504 SPB6: RISK MANAGEMENT AND MITIGATION L56 The Norwegian Influenza cohort (NorFlu): immune responses in pdmH1N1 exposed versus non-exposed pregnant women Savic, Miloje (1,4); Laake, Ida (2); Dembinski, Jennifer (1,4); Tunheim, Gro (1,4); Oftung, Fredrik (1,4); Hungnes, Olav (3); Næss, Lisbeth (1); Trogstad, Lill (2); Cox, Rebecca (5); Mjaaland, Siri (1,4); Waalen, Kristian (3) Vesikari, Timo (1); Forsten, Aino (1); Arora, Ashwani (2); Tsai, Theodore (2); Clemens, Ralf (2) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA VI TA B L E OF CON TE N TS L E C TU R E A BSTRAC TS SPB7: HOST FACTORS IN PATHOGENESIS L57 SPB701 Quantitative proteomic analysis of protein signatures in permissive vs. non-permissive influenza A virus infections in human host cells L58 Gerlach, Thomas; Matrosovich, Tatyana; Klenk, HansDieter; Matrosovich, Mikhail L59 The role of endothelial cells in influenza A virus pathogenesis PL0504 L64 Ghoneim, Hazem E. (1); Smith, Amber M. (1); McCullers, Jonathan A. (1,2) L60 L63 Comparison of aerosol and intra-nasal challenge with 2009 pandemic influenza virus (H1N1) in cynomolgus macaques showed clear differences in the distribution of virus Secondary Bacterial Pneumonia Suppresses Pulmonary CD8 and CD4 T Cell Responses after Influenza Infection Short, Kirsty Renfree (1); Kasper, Jennifer (2); Fouchier, Ron (1); Kirkpatrick, Charles (2); Kuiken, Thijs (1) 1: Erasmus MC, the Netherlands; 2: Department of Pathology, Medical University of Mainz, Mainz, Germany SPB704 Nakatsu, Sumiho (1); Sagara, Hiroshi (2); Noda, Takeshi (1,3); Kawaoka, Yoshihiro (1,4,5) Marriott, Anthony Colin (1), Sally Sharpe (1), Mike Dennis (1), Jennifer Kane (1), Claudia Prevosto (1), Nigel Silman (1), Emma Rayner (1), Simon Bate (1), Saranya Sridhar (2), Karl J. Staples (3), Ajit Lalvani (2), Tom Wilkinson (3), Miles W. Carroll (1) Inhibition of avian and human influenza viruses by human airway mucins SPB703 Understanding the genome packaging mechanism of influenza viruses PL0503 Sadewasser, Anne (1); Paki, Katharina (1); Eichelbaum, Katrin (2); Selbach, Matthias (2); Wolff, Thorsten (1) SPB702 L62 PL0502 Type I interferon receptor 2 (Ifnar2) plays an important role in limiting inflammation and disease following influenza virus infection PL0505 L65 Pathogenicity of airborne-transmissible H5N1 viruses. Mathilde Richard, Sander Herfst, Judith van den Brand, Pascal Lexmond, Theo Bestebroer, Ab Osterhaus, Thijs Kuiken and Ron Fouchier Tate, Michelle D; Dowling, Jennifer K; Piganis, Rebecca A; Hertzog, Paul J PL05: LATE BREAKERS PL0501 L61 Post-pandemic Review of anti-Influenza Drug Effectiveness (PRIDE Study): an investigation of the impact of neuraminidase inhibitor antiviral use on pneumonia and length of hospital stay in hospitalized influenza A(H1N1)pdm09 patients Muthuri, Stella; Myles, Puja; Venkatesan, Sudhir; Leonardi-Bee, Jo; Nguyen-Van-Tam, Jonathan TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA VII TA B L E OF CON TE N TS POSTE R A BSTRAC TS POSTER ABSTRACTS SPA1P06 SPA1: CLINICAL IMPACT AND DIAGNOSTIC APPROACHES COMPARATIVE ANALYSIS OF mariPOC SYSTEM AND rRT-PCR IN DETECTION OF INFLUENZA A VIRUS IN CLINICAL SAMPLES P2 SPA1P01 Clinical usefulness of the BD Veritor System for Rapid Detection of Flu A+B to detect influenza viruses Diagnosis of human influenza A virus infection using single chain fragment variable antibody-based competitive inhibition ELISA Rajput, Roopali (1); Sharma, Gaurav (2); Saxena, Latika (1); Khanna, Madhu (1); Pradhan, Hare Krishna (3); Pattnaik, B. (2) Hospitalizations with influenza in the northern hemisphere 2013-2014 influenza season. Results from the Global Influenza Hospital Surveillance Network SPA1P09 Influenza in pregnant women during 20122014, Moscow, Russia P14 Epidemiology of patients infected by Influenza B viruses in a northern Spanish population during 2012-2013 Influenza season P8 Aushakhmetova, Zabira T.; Kiyanbekova, Lyazzat S.; Abeev, Arman B.; Demesinova., Balzira M.; Kasenova, Zhulduz K. Ferro Bricks, Lucia (1); Falleiros, Luiza Helena (2); Mascareñas, Cesar (3); el Guerche-Séblain, Clotilde (4) SPA1P10 Trushakova, Svetlana (1); Kisteneva, Lidiya (1,2); Kruzhkova, Irina (2); Mukasheva, Evgeniya (1); Krasnoslobodtsev, Kirill (1); Siluyanova, Elina (1); Garina, Ekaterina (1); Kolobukhina, Ludmila (1,2); Burtseva, Elena (1) Laboratory monitoring of influenza like illnesses (ILI) and severe acute respiratory infections (SARI) in the flu sentinel surveillance system in the Republic of Kazakhstan during last three seasons – 20112014 P13 Influenza A and B burden in Latin American countries P6 SPA1P05 P11 Importance of Influenza infection in the etiology of exacerbations of COPD during a singular pandemic and post-pandemic period Sanz, Iván (1,2); Tamames, Sonia (1,3); Rojo, Silvia (1,2); Justel, Mar (2); Vega, Tomás (3); Ortiz de Lejarazu, Raúl (1,2) Puig-Barberà, Joan (1); Tormos, Anita Marie Catherine (1); Sominina, Anna (2); Ciblak, Meral (3); Mira-Iglesias, Ainara (1); Natividad-Sancho, Angels (1); Buigues-Vila, Amparo (1); Burtseva, Elena (4) SPA1P04 Grover, Sandeep (1); Weick, Anja (1); Obermeier, Patrick (1); Chen, Xi (1); Seeber, Lea (1); Tief, Franziska (1); Karsch, Katharina (1); Muehlhans, Susann (1); Hoppe, Christian (1); Adamou, Eleni (1,2); Behrens, Stephanie (1); Reiche, Janine (2); Schweiger, Brunhilde (2); Rath, Barbara (1) SPA1P08 P4 SPA1P03 P10 Seizure following respiratory viral infection versus immunization in infants and children – a syndromic surveillance study P3 Petrova, Ekateria; Krivitskaya, Vera; Pisareva, Maria; Buzitskaya, Zhanna; Sukhovetskaya, Vera; Danilenko, Daria; Suddenkova, Polina; Sominina, Anna A. SPA1P07 Noh, Ji Yun (1); Choi, Won Suk (1); Lee, Jacob (2); Seo, Yu Bin (2); Lee, Jung Hwa (3); Song, Joon Young (1); Cheong, Hee Jin (1); Kim, Woo Joo (1,4) SPA1P02 P9 Ortiz de Lejarazu, Raúl (1,2); Rojo, Silvia (1,2); López, Irene (2); López, Cristina (2); Tamames, Sonia (1,3); Sanz, Iván (1,2) SPA1P11 P15 Co-circulation of two lineages of influenza B viruses in South Korea Noh, Ji Yun (1); Lee, Han Sol (2); Song, Joon Young (1); Choi, Won Suk (1); Lee, Jacob (3); Seo, Yu Bin (3); Lee, JinSoo (4); Wie, Seong-Heon (5); Jeong, Hye Won (6); Kim, Young Keun (7); Park, Kyung Hwa (8); Kim, Shin Woo (9); Lee, Sun Hee (10); Lee, Jung Hwa (11); Kim, Dong Hyun (12); Woo, Sung Il (13); Lim, Chae Seung (14); Cho, Kyung Soon (15); Cheong, Hee Jin (1); Kim, Woo Joo (1,16) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA VIII TA B L E OF CON TE N TS POSTE R A BSTRAC TS P16 SPA1P12 Factors that influence the clinical outcome in patients admitted with influenza like illness and the effect of glucocorticoid treatment SPA2: EPIDEMICS AND PANDEMIC THREATS Tanriover, Mine Durusu (1); Ozisik, Lale (1); Akcay Ciblak, Meral (2); Yurtcu, Kubra (2); Unal, Serhat (3); Badur, Selim (2) P18 SPA1P13 Bo Shu, Kai-Hui Wu, William Davis, LaShondra Berman, Christine Warnes, Shannon Emery, Nathelia Barnes, Lakshmi Malapati, Julie Villanueva and Stephen Lindstrom P19 Shieh, Happy K. (1); Cheng, Ming-Chu (2); Chang, PoaChun (1) P21 Replication of MDCK-adapted viruses with different receptor specificity in vitro and in vivo Eropkin, Mikhail; Danilenko, Daria; Konovalova, Nadejda; Komissarov, Andrey; Pisareva, Maria; Grudinin, Mikhail; Lobova, Tamara; Schekanova, Svetlana; Kornilova, Ekaterina; Eropkina, Elena; Suddenkova, Polina P29 SPA2P05 Excess mortality risk attributable to influenza infection in Hong Kong, 1998-2012 Kuznetsova, Victoria; Isakova-Sivak, Irina; Rudenko, Larisa Wu, P (1); Goldstein, E (2); Ho, LM (1); Wu, JT (1); Ip, DKM (1); Leung, GM (1); Cowling, BJ (1) P22 Structural insight into extracellular domain of matrix protein 2 of influenza A virus P30 SPA2P06 Community psychological and behavioral responses to the threat of A(H7N9) in Hong Kong Kim, Kyung Hyun (1); Cho, Ki Joon (1,2,3); Schepens, Bert (2,3); Seok, Jong Hyeon (1); Kim, Sella (1); Rose, Kenny (2,3); Lee, Ji-Hye (1); Gallardo, Rodrigo (4); Schymkowitz, Joost (4); Rousseau, Frederic (4); Fiers, Walter (2,3); Saelens, Xavier (2,3); Chung, Mi Sook (5) Wu, P; Fang, VJ; Liao, Q; Ng, DMW; Wu, JT; Leung, GM; Fielding, R; Cowling, BJ P24 da Silva, Diogo V; Nordholm, Johan; Dou, Dan; Daniels, Robert P28 SPA2P04 INFLUENZA EPIDEMIC SEASON 2013-2014 IN RUSSIA: CHARACTERISTICS OF ISOLATED STRAINS Application of next-generation sequencing technologies to study the evolution of H5N2 avian influenza viruses in Taiwan The transmembrane domain of influenza NA has co-evolved with the distal head domain P27 Van Kerkhove, Maria D (1); Laurie, Karen (2); Engelhardt, Othmar (3); Wood, John (4); ., CONSISE (5) P20 SPB1P04 Wong, Jessica; Tsang, Tim K.; Wu, Peng; Lau, Eric H. Y.; Ip, Dennis K. M.; Cowling, Benjamin J. Improving Standardisation and Timeliness of Seroepidemiological Studies through the Global Partnership CONSISE (the Consortium for the Standardization of Influenza Seroepidemiology) SPB1: VIRUS STRUCTURE AND REPLICATION SPB1P03 Real-time estimation of the hospitalization fatality risk of influenza A(H1N1)pdm09 in Hong Kong SPA2P03 Kai-Hui Wu, C. McCord, B. Shu, C. Warnes, and S. Lindstrom SPB1P02 P26 SPA2P02 Performance validation of CDC real-time RT-PCR influenza assays on the AB TaqMan Array Card SPB1P01 Application of next-generation sequencing technologies to study the evolution of H5N2 avian influenza viruses in Taiwan Wong, Jessica Y. (1); Kelly, Heath (2,3); Cheung, ChungMei M. (4); Shiu, Eunice Y. (1); Wu, Peng (1); Ni, Michael Y. (1); Ip, Dennis K. M. (1); Cowling, Benjamin J. (1) Differentiation of influenza A(H3N2) variant viruses from human seasonal A(H3N2) viruses by real-time RT-PCR SPA1P14 P25 SPA2P01 SPA2P07 P31 The avian origin H9N2 polymerase, common to multiple human lethal strains, possesses robust activity in mammalian cells Cox, Andrew George (1,2); Kim, Yoel (1); O’Dell, Colleen (1); Schmierer, Jordana (1); Smith, Andrew (1,2); Dewhurst, Stephen (1) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA IX TA B L E OF CON TE N TS POSTE R A BSTRAC TS P32 SPA2P08 The Global Influenza B Study (GIBS): a Research Platform for the Study of Influenza B Transmission of the human influenza virus A/NL/602/09, but not the triple reassortant A/swine/Kansas/77778/07, occurs efficiently from low infectious dose in guinea pigs Paget, John (1); Caini, Saverio (1); Huang, Sue (2); Ciblak, Meral (3); Schellevis, Francois (1); Plotkin, Stanley (4) P33 SPA2P09 Possible explanations for why some countries were harder hit by Influenza A(H1N1)pdm09 – a global mortality impact modeling study Evolution of highly pathogenic avian influenza (H5N1) virus of domestic poultry in Vietnam between 2011 and 2013 P40 SPB2P01 P35 ANALYSIS OF INFLUENZA SENTINEL SURVEILLANCE RESULTS IN KAZAKHSTAN, 2013-2014 EPIDEMIOLOGICAL SEASON Relative role of individual complement pathway during influenza infection Rattan, Ajitanuj P40 SPB2P02 Flt3 signaling is critical for host response after influenza A infection Ozhanova, Alfiya Ibiraimovna; Mirzabekova, Gulfairuz Kuralbekovna P36 SOME APPROACHES TO PREDICTION OF SEASONAL INFLUENZA EPIDEMIC BURDEN Kühn, Nora (1); Hatesuer, Bastian (1); Dengler, Leonie (1); Wilk, Esther (1); Schäkel, Friederike (1); Pils, Marina (2); Beutler, Bruce (3); Schughart, Klaus (1) SPB2P03 Sominina, Anna A.; Karpova, Ludmila; Smorodintseva, Elizaveta; Grudinin, Mikhail; Pisareva, Maria; Komissarov, Andrei; Eropkin, Mikhail; Konovalova, Nadejda; Danilenko, Daria P37 SPA2P13 Hooiveld, Mariëtte (1); Donker, Gé (1); Meijer, Adam (2); Zock, Jan-Paul (1); Schellevis, François (1) SPB2: VIRAL FACTORS IN PATHOGENESIS Lee, Eun-Kyoung (1); Kang, Hyun-Mi (1); Song, ByungMin (1); Jeung, Jipseol (1); Choi, Jun-Gu (1); Thanh, Long To (2); Tho, Dang Nguyen (2); Choi, Kang-Seuk (1); Kye, Soo-Jeong (1); Kim, Ji-Ye (1); Lee, Hee-Soo (1); Lee, YounJeong (1) SPA2P12 P39 Influenza surveillance in the Netherlands: a new system covering 5% of the population that uses Electronic Medical Records P34 SPA2P11 Campbell, Patricia J. (1); Danzy, Shamika (1); Ramos, Irene (2); Fernandez-Sesma, Ana (2); Lowen, Anice C. (1); Steel, John (1) SPA2P15 Morales, Kathleen (1,2); Paget, John (1); Spreeuwenberg, Peter (1) SPA2P10 P38 SPA2P14 P41 H7N9 and H6N1 influenza A virus hemagglutinins engineered to bind human type receptors reveal a novel layer of specificity beyond the α2-6 linkage of sialic acid Influenza surveillance systems in Europe – a recent survey update de Vries, Robert P; Peng, Wenjie; McBride, Ryan; Paulson, James C Meerhoff, Tamara (1); Vermaire, Jorien (2); Jorgensen, Pernille (2); Gross, Diane (2); Pereyaslov, Dmitriy (2); Brown, Caroline (2) SPB2P04 P42 Activation of coagulation and tissue fibrin deposition in experimental influenza in ferrets Goeijenbier, Marco (1); van Gorp, Eric C.M. (1); van den Brand, Judith (1); Stittelaar, Koert (2); Bakthiari, Kamran (2); Roelofs, Joris T.H. (2); van Amerongen, Geert (1); Kuiken, Thijs (1); Martina, Byron (1); Meijers, Joost C.M. (3); Osterhaus, Albert D.M.E. (1) SPB2P05 P43 Analysis of the host response to influenza A virus infection in the Collaborative Cross founder strains Leist, Sarah R. (1); Pilzner, Carolin (1); Kollmus, Heike (1); Schughart, Klaus (1,2,3) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA X TA B L E OF CON TE N TS POSTE R A BSTRAC TS P44 SPB2P06 P51 SPB2P13 Type I interferon-mediated signaling is inhibited upon influenza A virus and Staphylococcus aureus co-infection Ubiquitination of the influenza A virus PB1-F2 protein is crucial for its biological functions Warnking, Kathrin; Klemm, Carolin; Löffler, Bettina; Niemann, Silke; Peters, Georg; Ludwig, Stephan; Ehrhardt, Christina Kosik, Ivan (1); Praznovska, Margareta (1); Kosikova, Martina (1); Vareckova, Eva (1); Kostolansky, Frantisek (1); Polakova, Katarina (2); Russ, Gustav (1) SPB2P07 P45 Saelens, Xavier; De Baets, Sarah; Verhelst, Judith; Van den Hoecke, Silvie; Smet, Anouk; Roose, Kenny; Schotsaert, Michael; Schepens, Bert; Fiers, Walter Klemm, Carolin (1); Warnking, Kathrin (1); Löffler, Bettina (2); Peters, Georg (2); Ludwig, Stephan (1); Ehrhardt, Christina (1) P46 SPB2P08 Shin, Dai-Lun (1,2); Hatesuer, Bastian (1); Schughart, Klaus (1,2,3) Mooij, Petra; Koopman, Gerrit; Mortier, Daniella; van Heteren, Melanie; Fagrouch, Zahra; de Laat, Rudy; Remarque, Edmond J.; Kondova, Ivanela; Verschoor, Ernst J.; Bogers, Willy M.J.M. Insights into the interaction of influenza A virus RNA polymerase with cellular RNA polymerase II P48 High basal expression of interferonstimulated genes in transformed human bronchial epithelial (BEAS-2B) cells contributes to influenza A virus resistance P49 van Riel, Debby (1); Leijten, Lonneke M. (1); Verdijk, Rob M. (2); GeurtsvanKessel, Corine (1); van der Vries, Erhard (1); van Rossum, Annemarie M.C. (3); Osterhaus, Albert. D.M.E. (1); Kuiken, Thijs (1) Pantin-Jackwood, Mary Josephine; Costa-Hurtado, Mar; Afonso, Claudio; Miller, Patti; Shepherd, Eric; Smith, Diane Virus dose-dependent neutrophil and lymphocyte proportions in peripheral blood during influenza A infection of mice Kostolansky, Frantisek (1); Dugovicova, Veronika (1); Janulikova, Jana (1); Mucha, Vojtech (1); Mistrikova, Jela (2); Vareckova, Eva (1) P57 Heterogeneous pathological outcomes after experimental pH1N1 influenza infection in ferrets correlate with viral replication and host immune responses in the lung. P58 SPB2P19 P50 Experimental co-infection of chickens with lentogenic, mesogenic and velogenic strains of Newcastle disease viruses and highly pathogenic avian influenza viruses P56 Vidana, Beatriz (1,3); Martínez, Pamela (3); Martínez, Jorge (1,3); Montoya, María (3,4); Martorell, Jaime (2); G. Migura, Lourdes (3); Majó, Natàlia (1,3) The olfactory nerve: A shortcut for influenza viruses into the CNS in humans !? SPB2P12 Janulikova, Jana; Bobisova, Zuzana; Mucha, Vojtech; Kostolansky, Frantisek; Vareckova, Eva SPB2P18 Seng, Lai-Giea; Daly, Janet; Chang, Kin-Chow; Kuchipudi, Suresh SPB2P11 Genetic background influences the antiviral activity of Mx1 gene to influenza virus infection in mice SPB2P17 Martínez-Alonso, Mónica; Hengrung, Narin; Vreede, Frank; Fodor, Ervin SPB2P10 P55 SPB2P16 P47 P54 SPB2P15 Genetic background influences the antiviral activity of Mx1 gene to influenza virus infection in mice Pandemic swine-origin H1N1 influenza virus replicates to higher levels and induces more fever and acute inflammatory cytokines in Cynomolgus versus Rhesus monkeys and can replicate in Common Marmosets SPB2P09 P53 SPB2P14 In vivo Virus Tropism and Protection by a Matrix Protein 2 Ectodomain-Specific Monoclonal Antibody revealed by a Novel GFP-expressing Influenza A Virus Lipoteichoic acid of Staphylococcus aureus as main contributor to the enhancement of influenza A virus induced mitogen-activated protein kinase signaling Species-specific host factors for Influenza A Virus replication Martin-Sancho, Laura (1); Karlas, Alexander (1); Imai, Aki (1); Barclay, Wendy (2); Meyer, Thomas F. (1) SPB2P20 P59 The relevance of cell cycle manipulation of influenza A virus to virus pathogenicity Xu, Ke TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XI TA B L E OF CON TE N TS POSTE R A BSTRAC TS P60 SPB2P21 TMPRSS2 is a host cell factor that is essential for pneumotropism and pathogenicity of H7N9 and H1N1 influenza A virus in mice The adaptation of avian influenza viruses to the respiratory epithelium of pigs Yang, Wei (1); Meng, Fandan (1); Punyadarsaniya, Darsaniya (2); Hoffmann, Markus (1); Stech, Juergen (3); Hoeper, Dirk (3); Beer, Martin (3); SchwegmannWessels, Christel (1); Ren, Xiaofeng (4); Herrler, Georg (1) Tarnow, Carolin (1); Engels, Geraldine (2); Arendt, Annika (1); Schwalm, Folker (1); Sediri, Hanna (1); Garten, Wolfgang (1); Klenk, Hans-Dieter (1); Gabriel, Gülsah (2); Böttcher-Friebertshäuser, Eva (1) P61 SPB2P22 SPB2P29 The effect of Streptococcus suis co-infection on the infection of well-differentiated porcine respiratory epithelial cells by swine influenza viruses Streptococcus suis affects the replication of swine influenza virus in porcine tracheal cells Wu, Nai-Huei (1); Meng, Fandan (1); Seitz, Maren (2); Valentin-Weigand, Peter (2); Herrler, Georg (1) P63 Virus and host determinants of influenza A virus restriction by human MxA Patzina, Corinna; Riegger, David; Haller, Otto; Kochs, Georg Viral replication kinetics and pathogenesis of pandemic H1N1 and H7N9 influenza virus infection in isogenic guinea pigs P69 PI3K-gamma activation during influenza A infection induces type I and type III IFN responses and resolution of inflammation via p38 activation Garcia, Cristiana Couto (1); Tavares, Luciana Pádua (1); Dias, Ana Carolina Fialho (1); Queiroz-Junior, Celso (1); Lima, Braulio Henrique Freire (1); Machado, Alexandre Magalhães Vieira (2); Sousa, Lirlândia Pires (1); Russo, Remo Castro (1); Teixeira, Mauro Martins (1) P70 Replicative Fitness of Avian Influenza A(H7N9) Virus Variants with Reduced Susceptibility to Neuraminidase Inhibitors in Mice and Ferrets Henju Marjuki (1), Vasiliy P. Mishin (1), Anton P. Chesnokov (1), (2), Joyce Jones (1), Juan A. De La Cruz (1), (2), Katrina Sleeman (1), Ho-Sheng Wu3, Feng-Yee Chang3, Ming-Tsan Liu3, Alicia M. Fry (1), Nancy J. Cox (1), Julie M. Villanueva (1), Charles T. Davis (1), Larisa V. Gubareva (1) Wiersma, Lidewij (1); Kreijtz, Joost (1); van Trierum, Stella (1); Nieuwkoop, Nella (1); van Run, Peter (1); van Amerongen, Geert (1); Ladwig, Mechthild (2); Banneke, Stefanie (2); Schaefer, Hubert (3); Osterhaus, Ab (1); Rimmelzwaan, Guus (1) SPB2P26 SPB2P30 SPB2P31 P64 SPB2P25 P68 Bertram, Stephanie (1); Schwalm, Folker (2); Preuß, Annette (1); Klenk, Hans-Dieter (2); Gabriel, Gülsah (1) P62 SPB2P23 H7N9 influenza A viruses exhibit importin-α mediated replication in the mammalian respiratory tract Meng, Fandan (1); Wu, Nai-Huei (1); Seitz, Maren (2); Valentin-Weigand, Peter (2); Ren, Xiaofeng (3); Herrler, Georg (1) SPB2P24 P67 SPB2P28 P65 The contribution of the PB1-F2 protein to viral virulence and pathogenesis of avain influenza virus SPA3: IMMUNOLOGY James, Joe (1,2); Moncorgé, Olivier (2); Barclay, Wendy (2); Shelton, Holly (1) SPA3P01 P66 SPB2P27 Hemagglutinin 222D/G polymorphism of pandemic influenza A (H1N1) 2009 viruses enables fast intra-host evolution and causes severe biphasic influenza in mice Seidel, Nora; Sauerbrei, Andreas; Wutzler, Peter; Schmidtke, Michaela P71 Back-boost of antibody landscapes after influenza virus infection or vaccination Fonville, Judith (1,2); Wilks, Sam (1,2); James, Sarah (1); Aban, Malet (3); Xue, Lumin (3); Jones, Terry (1,2); Ventresca, Mario (1); Fox, Annette (4); Nguyen Minh Hoa, Le (4); Quang Thai, Pham (5); Nhu Duong, Tran (5); Wong, Yan (1); Mosterin, Ana (1,2); Katzelnick, Leah (1,2); van der Net, Guido (6); Skepner, Eugene (1,2); Russell, Colin (2,7); Kaplan, Todd (8); Rimmelzwaan, Guus (6); Masurel, Nic (6); de Jong, Jan (6); Palache, Abraham (9); Beyer, Walter (6); Quynh Mai, Le (5); Tran Hien, Nguyen (5); Wertheim, Heiman (4); Hurt, Aeron (3); Osterhaus, Ab (6); Barr, Ian (3); Fouchier, Ron (6); Horby, Peter (4); Smith, Derek (1,2) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XII TA B L E OF CON TE N TS POSTE R A BSTRAC TS P73 SPA3P02 SPA3P09 Exposure history or immunosenescence – what determines the antibody response to influenza vaccine in elderly persons? Antibody response against unchanged influenza vaccine components in elderly people vaccinated in consecutive years Mosterín Höpping, Ana (1,4); McElhaney, Janet (2); Fonville, Judith (1,4); Beyer, Walter (3); Smith, Derek (1,4,3) Basileo, Michela (1); Iorio, Anna Maria (1); Bartolini, Guido (2); Tozzi, Paolo (3); Camilloni, Barbara (1) P75 SPA3P03 Serodiagnostic studies during the development of new pandemic caused A(H1N1)pdm09. P82 Searching for a universal biomarker of human T-cell responses to Influenza A virus infections Dembinski, Jennifer Lynn (1,3); Oftung, Fredrik (1,3); Savic, Miloje (1,3); Kim, Yohan (2); Peters, Bjoern (2); Mjaaland, Siri (1,3) Mukasheva, Evgeniya (1); Kolobukhina, Ludmila (1); Kisteneva, Lidiya (1); Zaplatnikov, Andrey (2); Smolonogina, Tatyana (3); Desheva, Yuliya (3); Burtseva, Elena (1) SPA3P11 P76 SPA3P04 SPA3P10 P81 Avian myotubes are highly susceptible to influenza virus infection and replication Chang, Kin-Chow (1); Baquero-Pereza, Belinda (1); Kuchipudi, Suresh V. (1); Ho, Jemima (1); Sebastian, Sujith (1); Brookesb, Sharon, M. (2); Brownb, Ian H. (2) P83 LPS-modified outer membrane vesicle (fmOMV) adjuvant provides protective innate immunity against influenza infection prior to the induction of vaccine-induced adaptive immune response Bae, Eun Hye; Lee, Tae Young; Lee, Sang Ho; Yeom, Min Joo; Na, Woon Seong; Kim, Chang Ung; Song, Dae Sub; Kim, Doo Jin; Kim, Sang Hyun P77 SPA3P05 Investigating B and T cell repertoire signatures in response to influenza infection SPB3: MATHEMATICAL MODELING Lu, I-Na; Farinelle, Sophie; Muller, Claude P. P78 SPA3P06 Influenza virus infection in quail (Coturnix coturnix): characterization of humoral immune response P79 Humoral and cellular immune responses following the 2009 pandemic Petukhova, Galina; Kuznetsova, Svetlana; Losev, Igor; Isakova-Sivak, Irina; Kuznetsova, Victoria; Korenkov, Daniil; Rudenko, Larisa; Naykhin, Anatoly P86 The relationship between school holidays and transmission of influenza in England and Wales 1967-2008 Jackson, Charlotte (1,2,3); Vynnycky, Emilia (1,2); Mangtani, Punam (1) P80 Contribution of single mutations specific for A/Leningrad/134/17/57 (H2N2) master donor virus in influenza A virulence and immunogenicity in a mouse model Tempia, Stefano (1,2,3); Walaza, Sibongile (3); Cohen, Adam (1,2); von Mollendorf, Claire (3); Moyes, Jocelyn (3,4); Mhlanga, Sarona (3); McAnerney, Johanna (3); Cohen, Cheryl (3,4) SPB3P02 Oftung, Fredrik (1); Korsvold, Gro Ellen (1); Dembinski, Jennifer (1); Tunheim, Gro (1); Savic, Miloje (1); Kristoffersen, Anne Cathrine (1); Haneberg, Bjørn (1); Germundsson Hauge, Anna (1); Kim, Yohan (2); Peters, Bjoern (2); Berdal, Jan Erik (4); Monceyron Jonassen, Chrstine (3,4); Mjaaland, Siri (1,5) SPA3P08 P84 Mortality Associated with Seasonal and Pandemic Influenza among Pregnant and Non-Pregnant Women of Childbearing Age in a High HIV-Prevalence Setting – South Africa, 1999-2009 Majo, Natalia (1,2); Busquets, Núria (1); Garcia, Beatriz (1); Bensaid, Albert (1); Dolz, Roser (1); Oliver, Salvador (1); Bertran, Kateri (1); Ramis, Antoni (1,2); Rivas, Raquel (1) SPA3P07 SPB3P01 SPB3P03 P87 A drug-disease model to investigate the effect of combination therapy with oseltamivir on influenza virus progression Kamal, Mohamed A (1); Gieschke, Ronald (2); LemenuelDiot, Annabelle (2); Beauchemin, Catherine AA (3); Smith, Patrick F (4,5); Rayner, Craig R (4,6) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XIII TA B L E OF CON TE N TS POSTE R A BSTRAC TS P89 SPB3P04 Dynamic modeling of the cost-effectiveness of sick leave practices for influenza illness SPA4P08 Comparative analysis and anti-viral activity of medicinal plant extracts against Influenza A virus: An in-vitro study. Edwards, Christina Hansen (1); de Blasio, Birgitte Freiesleben (1,2); Scalia Tomba, Gianpaolo (3) Roy, Saugata; Saxena, Latika; Kumar, Binod; Khanna, Madhu SPA4P09 SPA4: ANTIVIRALS AND RESISTANCE P90 SPA4P01 Evaluation of heterosubtypic crossprotection by active infection and TIVvaccination of human seasonal influenza virus in ferret models Oseltamivir inhibits influenza virus replication and transmission following ocular-only aerosol inoculation of ferrets P92 Vidana, Beatriz (1,3); Martorell, Jaime (2); Martínez, Jorge (1,3); Martínez, Pamela (3); G. Migura, Lourdes (3); córdoba, Lorena (3); Casas, Inmaculada (5); Pozo, Francisco (5); Majó, Natàlia (1,3); Montoya, María (3,4) P93 Is it possible to fight influenza by targeting intracellular redox state? P101 Hemagglutination (HA)-based neuraminidase (NA) inhibitory assays to search for novel NA inhibitors (NAIs) P94 Neuraminidase Inhibitors and the Cochrane Reviews – a critical appraisal Richter, Martina (1); Walther, Elisabeth (1); Bohn, Kathrin (1); Xu, Zhongli (1); Grienke, Ulrike (2); Rollinger, Judith M. (2); von Grafenstein, Susanne (3); Liedl, Klaus R. (3); Kirchmair, Johannes (4); Sauerbrei, Andreas (1); Schmidtke, Michaela (1) SPA4P13 Lehnert, Regine Magdalene; Matz, Sibylle Renate P95 SPA4P06 P100 Lina, Bruno (1); Boucher, Charles (2); Osterhaus, Albert (2); Schutten, Martin (2); Monto, Arnold (3); Whitley, Richard J (4); Nguyen-Van-Tam, Jonathan (5) SPA4P12 Palamara, Anna Teresa (1,2); Sgarbanti, Rossella (3); Amatore, Donatella (1,4); Celestino, Ignacio (1,4); Fraternale, Alessandra (5); Magnani, Mauro (5); Garaci, Enrico (3); Nencioni, Lucia (1) SPA4P05 SPA4P11 Five years of monitoring for the emergence of oseltamivir resistance in patients with influenza A virus infections in the Influenza Resistance Information Study (IRIS) Oseltamivir resistant and wild type pH1N1 virus infection in ferrets SPA4P04 P99 Novel inhibitors targeting influenza virus and pneumococcal neuraminidase (NA) Walther, Elisabeth (1); Richter, Martina (1); Xu, Zhongli (1); Bohn, Kathrin (1); Rollinger, Judith (2); von Grafenstein, Susannne (3); Liedl, Klaus (3); Kirchmair, Johannes (4); Sauerbrei, Andreas (1); Pfister, Wolfgang (5); Schmidtke, Michaela (1) Belser, Jessica A; Maines, Taronna R; Creager, Hannah M; Katz, Jacqueline M; Tumpey, Terrence M SPA4P03 Viral shedding and susceptibility to oseltamivir in hospitalised immunocompromised patients with influenza in the Influenza Resistance Information Study (IRIS) SPA4P10 P91 P98 Fraaij, Pieter (1); Schutten, Martin (1); Javouhey, Etienne (2); Burleigh, Laura (3); Outlaw, Russell (4); Kumar, Deepali (5); Boucher, Charles (1) Choi, Young-Ki SPA4P02 P97 Antiviral drugs for influenza -A comprehensive review of the evidence with emphasis on relevant clinical endpoints P102 Identification of amino acids important for binding of novel oseltamivir and zanamivir derivatives by using recombinant influenza viruses Hoffmann, Anja (1); Schade, Dennis (2); Kirchmair, Johannes (3); Sauerbrei, Andreas (1); Schmidtke, Michaela (1) Lehnert, Regine Magdalene (1); Pletz, Mathias W (2); Schaberg, Tom (3); Reuss, Annicka (4); Haas, Walter (4) P96 SPA4P07 Heterologous Polyclonal Antibodies, Past and Present, with Future Applications to Avian Influenza and Other Neglected Viruses. Dixit, Rashmi (1); Herbreteau, Cécile Hélène (2); Herz, Jenny (3); Booy, Robert (1); Lepine, Bertrand (2) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XIV TA B L E OF CON TE N TS POSTE R A BSTRAC TS P103 SPA4P14 P110 SPB4P05 Antiviral effect of new oseltamivir derivates against influenza A virus Serological monitoring of equine influenza after vaccination in Korea in 2013 García-Machorro, Jazmín (1); Neri-Bazan, Rocio M. (1); Correa-Basurto, José (1); Trujillo-Ferrara, José G. (1); Tolentino-López, Luis (1); Martínez-Ramos, Federico (2); Velazquez-Quiroz, Isaac (3); Jímenez-Estrada, Juan M. (3); Soriano-Ursúa, Marvin A. (1); Aguilar-Faisal, José L. (1) Kim, Bo-Hye (1); Yang, Sunjoo (2); Kim, Eun-Ju (1); Shin, Ye-Jin (1); Song, Jae-Young (1); Shin, Yeun-Kyung (1) SPB4P06 P104 SPA4P15 Monitoring Avian Influenza Virus in a small Spanish wetland using non-invasive sampling methods. Torrontegui, Olalla (1); Álvarez, Vega (1); Gerrikagoitia, Xeider (1); Höfle, Ursula (2); Barral, Marta (1) Indirect effects of oseltamivir treatment of an influenza-infected index case-patient on secondary household transmission: A randomized placebo-controlled clinical trial in a crowded urban area in Bangladesh P112 SPB4P07 Influenza A(H1N1)pdm09 virus in pigs, Togo, 2013 Alicia M Fry (1), Doli Goswami (2), Kamrun Nahar (2), Amina Tahia Sharmin (2), Mustafizur Rahmun (2), Larisa Gubareva (1), Tasnim Azim (2), Joseph Bresee (1), Stephen P Luby (2) (3), W Abdullah Brooks (2) Ducatez, Mariette (1); Webby, Richard (2); Awoume, Félix (3) P113 SPB4P08 SPB4: ANIMAL FLU-ECOLOGY AND EPIDEMIOLOGY OF ANIMAL INFLUENZA P106 SPB4P01 Phylogenetic relationships of genes of hemagglutinin and matrix protein of influenza A/equine/Kazakhstan/236/12 (H3N8) virus P107 Surveillance of influenza virus subtypes H1, H2, H3 among wild birds in Ukraine in 20062012 P108 Barral, Marta (1); Alvarez, Vega (1); Busquets, Nuria (2); Gerrikagoitia, Xeider (1); Minguijón, Esmeralda (1); Costa, Tania (2); Ramis, Antonio (2); Majo, Natalia (2) P109 Sero-prevalence of antibodies against H5N1 and H9N2 avian influenza viruses among Egyptians: Results of a prospective, controlled, sero-epidemiological study. Kayali, Ghazi (1); Webby, Richard J (1); Ali, Mohamed A (2) P114 Prior infection of pigs with a European H3N2 SIV confers partial protection against a North American swine-origin H3N2v influenza virus SPB4P10 Tissue distribution of low pathogenic avian influenza virus in naturally infected wild birds. SPB4P04 Krauss, Scott L. (1); Webster, Robert G. (1); Danner, Angela (1); Friedman, Kimberly (1); Knowles, James (1); Ghazi, Kayali (1); Niles, Lawrence J. (2); Dey, Amanda D. (3); Raven, Garnet (4); Pryor, Paul (4); Stucker, Karla (5); Schobel, Seth (5); Stockwell, Timothy B. (5); Lin, Xudong (5); Wentworth, David (5) QIU, YU; Mancera Gracia, José Carlos; Li, Yewei; Trus, Ivan; Nguyen Van, Ut; Van Reeth, Kristien Muzyka, Denys (1); Pantin-Jackwood, Mary (2); Stegniy, Borys (1) SPB4P03 Long term surveillance of H7 influenza viruses in American wild aquatic birds: Concordance with emergence of variants with pathogenic potential? SPB4P09 Khan, Yelizaveta SPB4P02 P111 P115 Biosecurity practices in small commercial poultry farms, Bangladesh 2011-12 Rimi, Nadia Ali; Sultana, Rebeca; Muhsina, Mushtari; Uddin, Baktiar; Haider, Najmul; Nahar, Nazmun; SturmRamirez, Katharine; Luby, Stephen P. SPA5: VACCINES: CURRENT AND NOVEL APPROACHES SPA5P01 P116 Multi-component adjuvants for inactivated influenza vaccines: comparative studies in a preclinical setting Vasiliev, Y.M.; Kashirina, O.S.; Chernikova, M.I. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XV TA B L E OF CON TE N TS POSTE R A BSTRAC TS SPA5P02 P117 Characteristics of chitosan-based adjuvants determine immunogenicity of inactivated influenza vaccines in mice P118 A comparative study of adjuvants with different mechanisms of action for influenza vaccines in mice P119 Epidemiologic performance and influenza vaccination prophylaxis in Russia P120 Comparison of immune response induced by candidate recombinant influenza vaccines based on heterologous M2e linked to fulllength and truncated forms of flagellin Stepanova, Liudmila (1); Kotlyarov, Roman (2); Kovaleva, Anna (1); Potapchuk, Marina (1); Korotkov, Alexandr (1); Sergeeva, Maria (1); Kasianenko, Marina (1); Kuprianov, Victor (2); Ravin, Nicolai (2); Tsybalova, Liudmila (1) A Novel Influenza Vaccination Strategy based on DNA vaccines encoding M2 ectodomain fused with adjuvant proteins against Pandemic Influenza Viruses Humoral immunity induced by seasonal influenza vaccine in humans protects against H5N1 challenge in mice P129 Adjuvation broadens the protective efficacy of a seasonal influenza vaccine in mice SPA5P14 P130 Universal influenza vaccine development based on the MVA vector platform P124 Roos, Anna; Roozendaal, Ramon; Theeuwsen, Jessica; Riahi, Sarra; Vaneman, Joost; Tolboom, Jeroen; Koldijk, Martin; Dekking, Liesbeth; Koudstaal, Wouter; Goudsmit, Jaap; Radošević, Katarina P128 Cross-reactive antibodies and specific CD8 T-cells induced by conserved consensus HA2 of influenza viruses A/H2N2 delivered with flagellin Cox, Freek; Saeland, Eirikur; Baart, Matthijs; Koldijk, Martin; Goudsmit, Jaap; Radosevic, Katarina Roozendaal, Ramon; Tolboom, Jeroen; Roos, Anna; Riahi, Sarra; Theeuwsen, Jessica; Bujny, Miriam V.; Klaren, Vincent; Korse, Hans J.W.M.; Dekking, Liesbeth; Grootenhuis, Arijan; Weverling, Gerrit Jan; Koudstaal, Wouter; Goudsmit, Jaap; Radošević, Katarina Humoral protection against H5N1 influenza by multiple immunizations with seasonal influenza vaccine in mice Isakova-Sivak, Irina (1); de Jonge, Jorgen (2); Smolonogina, Tatiana (1); Rekstin, Andrey (1); Kiseleva, Irina (1); Kuznetsova, Victoria (1); Donina, Svetlana (1); Petukhova, Galina (1); Naykhin, Anatoly (1); Pisareva, Maria (3); Stukova, Marina (3); Erofeeva, Mariana (3); Tsvetnitsky, Vadim (4); Flores, Jorge (4); Rudenko, Larisa (1) SPA5P13 P123 SPA5P08 P127 Stepanova, Liudmila; Potapchuk, Marina; Kuznetsov, Vasiliy; Sergeeva, Maria; Kovaleva, Anna; Korotkov, Alexandr; Tsybalova, Liudmila Yi, Hwajung; Seo, Ki-Weon; Lee, Mi-Seon; Kang, Chun; Kim, Kisoon SPA5P07 Development, pre-clinical and clinical evaluation of potentially pandemic H2N2 live attenuated influenza vaccine SPA5P12 P122 SPA5P06 Vidyaeva, Inna; Potapchuk, Marina; Petrov, Sergei; Sergeeva, Maria; Tsybalova, Liudmila SPA5P11 Briko, Nikolay Ivanovich SPA5P05 P126 SPA5P10 Evaluation of attenuate and reproductive properties of influenza A vaccine strain RA35 (H7N9) based on new donor strain A/ HongKong/1/68/162/35. Chernikova, M.I. (1); Kashirina, O.S. (1); Khasanova, L.M. (1,2); Vasiliev, Y.M. (1) SPA5P04 Improved vaccine-induced immune responses to influenza antigens. Gilbert, Sarah Catherine (1); Antrobus, Richard D (1); Berthoud, Tamara K (1); Mullarkey, Caitlin E (1); Hoschler, Katja (2); Coughlan, Lynda (1); Lambe, Teresa (1); Tully, Claire (1); Zambon, Maria (2); Hill, Adrian VS (1) Khasanova, L.M. (1,2); Kashirina, O.S. (1); Chernikova, M.I. (1); Vasiliev, Y.M. (1) SPA5P03 P125 SPA5P09 Altenburg, Arwen F.; Kreijtz, Joost H.C.M.; de Vries, Rory D.; De Gruyter, Heidi L.M.; Osterhaus, Albert D.M.E.; Rimmelzwaan, Guus F. SPA5P15 P131 Influence of different schedules of chicken immunization with DNA vaccine against avian influenza H5N1 virus on antibody response Góra-Sochacka, Anna; Stachyra, Anna; Sirko, Agnieszka TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XVI TA B L E OF CON TE N TS POSTE R A BSTRAC TS SPA5P16 P132 A universal influenza virus vaccine strategy based on the conserved stalk domain of the hemagglutinin P133 P134 Yeom, Minjoo (1,2); Na, Woonsung (1,2); Hong, Minki (1,2); Kim, Doo-Jin (1); Jung, Dae-Gwin (1,2); Kim, JungKi (3); Kim, Sang-Hyun (1); Song, Daesub (1,2) SPA5P26 Evaluation of the campaign’s impacts of influenza vaccination in the productivity of workers of brazilians industries Adam Johnson (1), Emily Winne (2), David Cureton (1), Callie Ridenour (1), Wanda Santana (2), Taejoong Kim (1), John R. Barr (2), Ruben O. Donis (1), Julie Villanueva (1), Tracie Williams (2), Li-Mei Chen (1) P135 SPA5P27 Cross-protection by human and avian M2edisplaying virus-like particles P136 Mice immunization against influenza with three variants of DNA vaccine encoding hemagglutinin.from H5N1. Redkiewicz, Patrycja (1); Góra-Sochacka, Anna (1); Kosson, Piotr (2); Sirko, Agnieszka (1) P137 SPA5P21 Assessment of the public health benefit of quadrivalent influenza vaccine in the United Kingdom from 1996–97 to 2008–09 seasons SPB5: GENETICS AND EVOLUTION OF VIRUS AND HOST P144 Adaptation of a human influenza virus to two mouse strains with different genetic backgrounds P138 Evaluation of immunogenicity and crossprotective efficacy of MVAtor™-based universal influenza vaccine candidates in mice against H1N1, H5N1 and H7N9 influenza strains Stricker, Ruth L.O. (1); Leist, Sarah R. (1); Schughart, Klaus (1,2,3) SPB5P02 P145 Host-specific distribution of (+)-RNA secondary structures in segment 8 of influenza A viruses Auer, Sebastian; Wachs, Frank-Peter; Leyrer, Sonja P139 SPA5P23 Callie Ridenour (1), Adam Johnson (1), Emily Winne (2), Jaber Hossain (1), Guaniri Mateu-Petit (1), Amanda Balish (1), Wanda Santana (2), Taejoong Kim (1), Todd Davis (1), John R. Barr (2), Ruben O. Donis (1), Julie Villanueva (1), Tracie Williams (2), Li-Mei Chen (1) SPB5P01 Matias, Goncalo (1); Taylor, Robert J. (2); Haguinet, Francois (1); Kim, WonGyu Lewis (2); Lustig, Roger (2); Fleming, Douglas M. (3) SPA5P22 P143 Development of influenza A(H7N9) candidate vaccine viruses with improved hemagglutinin antigen yield in eggs Christopoulou, Ioanna (1,2); Schotsaert, Michael (1,2); Roose, Kenny (1,2); Fiers, Walter (1,2); Saelens, Xavier (1,2) SPA5P20 P142 Increased Hemagglutinin Yield of Influenza Vaccine Viruses by Incorporation of Homologous PB1 Gene Mattos, Bianca Ramos de Freitas (1); Araujo, Gabriela Tannus Branco (2); Fonseca, Marcelo Cunio Machado (2); Sansone, Dayan (2); Homsani, Sheila (3); Bricks, Lucia Ferro (3); Liao, Paulo Sti Lin (3); Guarino, Hubert (3) P141 Timerized Hemagglutinin Stalk Domain Based Vaccine Protect against Canine Influenza Virus Poulsen Nautrup, Barbara (1); Meier, Geneviève (2); Anastassopoulou, Anastassia (3); Welte, Robert (3); Gregg, Meghann (2) SPA5P19 P140 Magini, Diletta (1,2); Buccato, Scilla (2); Mangiavacchi, Simona (2); Giovani, Cinzia (2); Tavarini, Simona (2); Maione, Domenico (2); Brito, Luis (3); Nuti, Sandra (2); Mason, Peter (3); Settembre, Ethan (3); Montomoli, Emanuele (1); Geall, Andrew (3); Brazzoli, Michela (2); Bertholet, Sylvie (2) SPA5P25 Cost-effectiveness of quadrivalent versus trivalent influenza vaccine in Germany: a Markov multi-cohort model SPA5P18 Characterization of T cell responses induced by Flu SAM®(NP) and SAM®(M1) vaccines Krammer, Florian (1); Margine, Irina (1,2); Nachbagauer, Raffael (1); Pica, Natalie (1,2); Hai, Rong (1); Albrecht, Randy A. (1,4); García-Sastre, Adolfo (1,3,4); Palese, Peter (1,3) SPA5P17 SPA5P24 Vasin, Andrey (1,2); Petrova, Alexandra (1,2); Plotnikova, Marina (1); Klotchenko, Sergey (1); Egorov, Vladimir (1); Kiselev, Oleg (1) Prime-boost DNA vaccination protects chickens against challenge with homologues and heterologues H5N1 virus Stachyra, Anna (1); Smietanka, Krzysztof (2); Minta, Zenon (2); Gora-Sochacka, Anna (1); Sirko, Agnieszka (1) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XVII TA B L E OF CON TE N TS POSTE R A BSTRAC TS P146 SPB5P03 Changes in receptor binding properties of influenza A(H3N2) and influenza B viruses and their impact on antigenic characterization H1N1 IAVs exploited the co-translational insertion process to decrease their NA transmembrane domain hydrophobicity Dou, Dan; da Silva, Diogo V; Nordholm, Johan; Daniels, Robert Lin, Yipu; Gu, Yan; Wharton, Stephen; Whittaker, Lynne; Gregory, Victoria; Li, Xiaoyan; Metin, Simon; Cattle, Nicholas; Daniels, Rodney; Hay, Alan; McCauley, John SPB5P04 SPB5P11 P147 Evolution of highly pathogenic avian influenza H7 virus from low pathogenicity precursors in ovo SPB5P12 P148 Molecular peculiarities of influenza A and B viruses circulating in Russia during two epidemic seasons in 2012-2014 Phylogenetic and principal component analyses of influenza virus sequence data from the first five years (2009–2013) of the IRIS study show subtype distinct geographical patterns in global epidemics P157 Comparison of common genotypes of Chinese H7 avian influenza viruses for replication and transmission in chickens Identifying Antigenic Regions of H9 Haemagglutinin of Avian Influenza David L. Suarez and Marisela Rodriguez SPB5P15 P158 Sequencing artifacts in the type A influenza database and attempts to correct them Peacock, Thomas Philip (1,2); Reddy, Kolli B (1); Shelton, Holly (1); Barclay, Wendy S (2); Iqbal, Munir (1) David L. Suarez (1), and Nikki Chester (2), P151 SPB5P08 EPITOPE MAPPING OF THE HEMAGGLUTININ MOLECULE OF INFLUENZA B/YAMAGATA AND B/VICTORIA LINEAGE VIRUSES USING MONOCLONAL ANTIBODIES SPA6: EVALUATION OF VACCINE SAFETY AND EFFECTIVENESS Sorokin, Evgenii; Tsareva, Tatiana; Sominina, Anna A.; Pisareva, Maria; Komissarov, Andrei; Kosheleva, Anna SPA6P01 P152 SPB5P09 Analysis of mammalian adaptation in Influenza from surveillance data Burke, David Francis; Smith, Derek J Strain specificity of serum hemagglutinationinhibition antibody responses in humans infected with 2009 pandemic influenza A(H1N1) virus SPB5P14 P150 P156 Xiuhua Lu, Feng Liu, Vic Veguilla, Min Levine, and Jacqueline M Katz van der Vries, Erhard (1); Zhang, Jitao David (2); Boucher, Charles (1); Schutten, Martin (1) SPB5P07 P155 Use of deep-sequencing to evaluate the intrinsic heterogeneity of human influenza type A viruses directly in nasal swabs SPB5P13 P149 P154 Barbezange, Cyril (1); Blanc, Hervé (2); Isakov, Ofer (3); Enouf, Vincent (1); Shomron, Noam (3); van der Werf, Sylvie (1); Vignuzzi, Marco (2) Komissarov, Andrey; Kosheleva, Anna; Fadeev, Artem; Elpaeva, Ekaterina; Mikhailova, Maria; Pisareva, Maria; Buzitskaya, Janna; Stukova, Marina; Danilenko, Daria; Konovalova, Nadejda; Eropkin, Mikhail; Grudinin, Mikhail SPB5P06 Influenza A and B intertypic reassortment is restricted by incompatible viral packaging signals Baker, Steven F. (1); Nogales, Aitor (1); Finch, Courtney (4); Tuffy, Kevin (1); Domm, William (1); Perez, Daniel R. (4); Topham, David J. (1,2,3); Martínez-Sobrido, Luis (1) Hanna, Amanda (1,2); Howard, Wendy A (1); Núñez, Alejandro (1); Hicks, Daniel (1); Barclay, Wendy S (2); Banks, Jill (1) SPB5P05 P153 SPB5P10 P159 Effectiveness of influenza and pneumococcal vaccines in preventing pneumonia development and hospitalization: a prospective cohort study Song, Joon Young (1,10); Lee, Jin Soo (2); Wie, SeongHeon (3); Kim, Hyo Youl (4); Lee, Jacob (5); Seo, Yu Bin (5); Jeong, Hye Won (6); Kim, Shin Woo (7); Lee, Sun Hee (8); Park, Kyung Hwa (9); Noh, Ji Yun (1,10); Choi, Won Suk (1); Cheong, Hee Jin (1); Kim, Woo Joo (1,10) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XVIII TA B L E OF CON TE N TS POSTE R A BSTRAC TS P160 SPA6P02 Influenza vaccine effectiveness to prevent admissions with influenza in adults belonging to target groups for vaccination in the Valencia Hospital Network. A testnegative study, 2013-2014 influenza season SPA6P07 P168 Immunogenicity and safety of an AS03adjuvanted H7N1 vaccine in an elderly population Madan, Anu (1); Ferguson, Murdo (2); Rheault, Paul (3); Seiden, David (4); Friel, Damien (5); Soni, Jyoti (6); Li, Ping (1); Innis, Bruce L. (1); Schuind, Anne (1) Puig-Barberà, Joan (1,2); Carballido-Fernández, Mario (3); Limón-Ramírez, Ramón (4); Tortajada-Girbés, Miguel (5); Otero-Reigada, María Carmen (6); Mollar-Maseres, Juan (6); Carratalá-Munuera, Concha (7); Gil-Guillén, Vicente (7); Natividad-Sancho, Angels (1); Tormos, Anita (1); Buigues-Vila, Amparo (1); Mira-Iglesias, Ainara (1); López-Labrador, Francisco Xavier (1,8); Díez-Domingo, Javier (1) SPA6P08 P169 Influenza A/H3N2 mutations causing vaccine mismatches and possibly associated with more severe disease, Singapore, 2009-2013 Lee, Hong Kai P162 SPA6P03 Influenza vaccine effectiveness and averted medically-attended influenza cases, seasons 2011/12, 2012/13 and 2013/14 SPB6: RISK MANAGEMENT AND MITIGATION Reuss, Annicka; Buda, Silke; An der Heiden, Matthias; Schweiger, Brunhilde; Wedde, Marianne; Haas, Walter; Buchholz, Udo SPB6P01 P164 SPA6P04 Vaccine effectiveness estimates in preventing laboratory-confirmed mild and moderate-tosevere influenza in the Belgian population during the 2012-2013 season Leclercq, India (1,2); Pariente, Kevin (1); Sawoo, Olivier (1,2); Feher, Maxence (1); Vandenbogaert, Mathias (1); Manuguerra, Jean-Claude (1) SPB6P02 Hombrouck, Anneleen (1); Bossuyt, Nathalie (2); Van Casteren, Viviane (2); Van Gucht, Steven (1); Quoilin, Sophie (2); Wuillaume, Françoise (2); Thomas, Isabelle (1) Immunogenicity and safety of AS03adjuvanted H7 vaccines in adults ≤64 years of age: Phase I/II, randomized, observerblind, placebo-controlled, multi-center trials in the United States and Canada SPB7P01 Prevato, Marua (1); Nandi, Avishek (3,4); Lilja, Anders (4); Giusti, Fabiola (1); Ferlenghi, Ilaria (2); Buccato, Scilla (2); Cozzi, Roberta (2); Giovani, Cinzia (2); Maione, Domenico (2); Brito, Luis (4); Geall, Andrew (4); Montomoli, Emanuele (1); Bertholet, Sylvie (2); Legay, Francois (2); Bonci, Alessandra (2) P172 Emerging anti-influenza agents Kainov, Denis P166 The «forgotten antigen» of Influenza virus: a novel approach to study immunity to neuraminidase Edwards, Christina Hansen (1); de Blasio, Birgitte Freiesleben (1,2); Tomba, Gianpaolo Scalia (3) SPB7: HOST FACTORS IN PATHOGENESIS Madan, Anu (1); Segall, Nathan (2); Ferguson, Murdo (3); Sheldon, Eric (4); Frenette, Louise (5); Chu, Laurence (6); Rheault, Paul (7); Kroll, Robin (8); Friel, Damien (9); Soni, Jyoti (10); Li, Ping (1); Innis, Bruce L. (1); Schuind, Anne (1) SPA6P06 P171 Recommendations and policies for sick leave during seasonal and pandemic influenza in Europe P165 SPA6P05 P170 Identification of molecular determinants involved in Influenza A H5N1 virus survival in the environment SPB7P02 P173 The impact of school dismissal and vaccination on influenza transmission: an alternative to school closure Voirin, Nicolas (1); Payet, Cécile (1); Régis, Corinne (1); Barrat, Alain (2); Cattuto, Ciro (3); Pinton, Jean-François (4); Lina, Bruno (5); Vanhems, Philippe (1) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XIX TA B L E OF CON TE N TS POSTE R A BSTRAC TS P174 SPB7P03 Understanding reasons behind HCW participation and non-participation in seasonal influenza vaccination in Podgorica, Montenegro to tailor strategies that increase uptake. Meier, Geneviève; Gregg, Meghann PL05P07 P175 Pre-existing neutralizing antibodies against potential pandemic influenza viruses in middle-aged adults vaccinated annually with seasonal influenza vaccines P176 PL05P09 P178 Ferret models to study clinical intervention strategies against influenza. Szurgot, Inga (1); Szolajska, Ewa (1); Laurin, David (2); Lambrecht, Benedicte (3); Chroboczek, Jadwiga (1,2) PL05P10 Stittelaar, Koert (1); Mallett, Corey (2); de Waal, Leon (1); Veldhuis Kroeze, Edwin (1); van Amerongen, Geert (1); van den Brand, Judith (3); van der Vries, Erhard (3); Osterhaus, Ab (1,3) P179 Results of phase II and phase III studies of AS03-adjuvanted cell culture-based H5N1 influenza vaccine (KD-295) P185 Exploratory Study for Risk Group of Psychogenic Illness Following Vaccination: Experience from Mass Immunization Campaign Against Pandemic Influenza A (H1N1) 2009 in Republic of Korea Yang, Taeun; Park, Young-Joon; Kim, Hee Jung; Lee, Yeon Kyeong; Park, Ok PL05P11 Naruse, Takeshi; Tanabe, Tetsuro; Fukuda, Tadashi; Ichikawa, Munetaka; Oda, Yoshiaki; Tochihara, Shinji; Kino, Yoichiro P186 Sensitivity, specificity and predictive values of clinical definitions of influenza P180 Investigating the potential for temporary immunity between influenza viruses in the ferret model P184 Self-adjuvanting influenza candidate vaccine carrying HA and M1 epitopes on a proteinaceous multivalent nanoplatform Jorge Tavel, Jacqueline McBride, Rong Deng, Michael Derby, Tracy Burgess, Ning Chai, PL05P05 P183 Effectiveness of inactivated influenza vaccine in children less than 3 years of age over multiple influenza seasons Chang, Chia-Kun (1); Tsuei, Hsiang (2); Chih, Yi-Chien (1); Lee, Chia-Lin (1); Chou, Shu-Mei (1); Yang, Chih-Hui (1) Clinical Safety and Efficacy of MHAA4549A, A Novel Monoclonal Antibody for the Treatment of Severe Influenza A: Results of a Randomized, Double-Blind, Placebo Controlled Clinical Trial PL05P04 Liu, Marcy Heng (1); Robinson, Stuart (2); Ben-Yedidia, Tamar (3); Wanderley, Wilson Caparros (2); Pleguezuelos, Olga (2); Gottlieb, Tanya (3); Babecoff, Ron (3); Schmidt, Ed (4); Huckriede, Anke (5); Van Doorn, Eva (1); Hak, Eelko (1) PL05P08 Wei Wang, Esmeralda Alvarado, Qiong Chen, Dorothy Scott, Russell Vassell, and Carol D. Weiss PL05P03 P182 Design of randomized, double-blind, controlled, multi-center phase IIb trials as part of the EU-funded UNISEC project to assess the safety, immunogenicity and clinical efficacy of cross-seasonal universal influenza vaccines with or without pandemic influenza vaccine in healthy adults. PL05: LATE BREAKERS PL05P02 P181 Cost-effectiveness analysis of quadrivalent influenza vaccination in the elderly: an update of a united kingdom analysis Likhite, Nathalie Kavita (1); Kavaric, Nebosja (2); Grbovic, Mensud (3); Terzic, Natasa (4); Brajovic, Mina (5); Jorgensen, Pernille (1); Caroline, Brown (6) PL05P01 PL05P06 Cohen Jean Marie 1, Gaston De Serres 2, Isabelle Daviaud1, Anne Mosnier 1, Tan Tai Bui 1, Vincent Enouf 3, Martine Valette 4, Michel Lamure 5 with the help of doctors and virologists in the GROG network. Laurie, Karen (1), Teagan Guarnaccia(1),(2), Louise Carolan(1), Ada Yan(3), Malet Aban(1), Patrick Reading(1), Anne Kelso(1), Jennifer Mosse (2), James McCaw(3),(4), Ian Barr(1) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XX TA B L E OF CON TE N TS L E C TU R E A BSTRAC TS P188 PL05P12 PL05P18 Efficacy of chicken immunization against H5N1 influenza virus with bacterially produced hemagglutinin protein. The fraction of influenza virus infections that are asymptomatic: a systematic review and meta-analysis Saczynska, Violetta (1); Romanik, Agnieszka (1); Florys, Katarzyna (1); Cecuda-Adamczewska, Violetta (1); Kęsik-Brodacka, Małgorzata (1); Łukasiewicz, Natalia (1); Sokołowska, Iwona (1); Minta, Zenon (2); Smietanka, Krzysztof (2); Szewczyk, Bogusław (3); Płucienniczak, Grazyna (1); Płucienniczak, Andrzej (1) Leung, Nancy; Xu, Cuiling; Ip, Dennis; Cowling, Benjamin PL05P19 P189 PL05P13 Airway fluids from mice and ferret contain different innate immune proteins that mediate antiviral activity against influenza A viruses P194 P195 Expression, purification and immunological properties of glycosylated influenza H5N1 hemagglutinin produced in Pichia pastoris Kopera, Edyta; Zagórski-Ostoja, Włodzimierz; Grzelak, Krystyna; Protas-Klukowska, Anna Maria; Zdanowski, Konrad; Pietrzak, Maria; Macioła, Agnieszka PL05P20 P196 RSV infection in neonates Job, Emma (1,2); Short, Kirsty (2); Deng, Yi-Mo (3); Laurie, Karen (3); Brooks, Andrew (2); Saelens, Xavier (1); Reading, Patrick (2,3) Hammoud, Majeda Sabri P190 PL05P14 Diagnostic reassortant influenza strains for anti-neuraminidase antibody detection in clinical studies of live influenza vaccine Smolonogina, Tatiana; Desheva, Yulia; Donina, Svetlana; Rekstin, Andrey; Rudenko, Larisa PL05P15 P191 MUC1 enhances influenza binding and infection of epithelial cells Allen, Robert John; Brown, Lorena Elizabeth; McAuley, Julie Louise P192 PL05P16 Use of government-funded antiviral drugs for containment of an influenza A(H1N1)pdm09 outbreak in a long-term care psychiatric facility, 2014 Lin, Mei-Ling (1); Teng, Ya-Wen (2); Chih, Yi-Chien (1); Chang, Chia-Kun (1); Chou, Shu-Mei (1); Yang, Chih-Hui (1) PL05P17 P193 Circular DNAzyme against the BM2 gene transcript of influenza B virus: a potent inhibitor of virus replication in host cells Kumar, Binod; Rajput, Roopali; Kumar, Prashant; Khanna, Madhu TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA XXI L E C TU R E A BSTRAC TS LECTU RE A B STR ACTS TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L1 L E C TU R E A BSTRAC TS SPA1: CLINICAL IMPACT AND DIAGNOSTIC APPROACHES SPA101 OMEGA Ability of the Luminex xTAG RVP to detect zoonotic influenza viruses with pandemic potential Jörn Winter, Christine Warnes and Stephen Lindstrom Influenza Division, Centers for Disease Control and Prevention, Atlanta, GA 30333, U.S.A. The Luminex xTAG Respiratory Virus Panel (RVP) is a PCR-based, qualitative assay used for the diagnosis and surveillance of multiple human respiratory viruses, including human influenza virus. Due to country-specific regulations, the number of viruses detected by the assay varies. While the xTAG RVP is intended to detect clinical infections with human influenza viruses, it is important to understand the ability of the test to detect zoonotic influenza type A viruses that have caused sporadic infections in humans such as swine-origin A(H1N1), A(H1N2) or A(H3N2)v viruses as well as avian A(H7N3), A(H7N9), and highly pathogenic A(H5N1) influenza. Animal viruses that have the potential to cause outbreaks among humans differ genetically from human seasonal viruses and may show variable genetic diversity. In this study we evaluated the analytical performance of the xTAG RVP to demonstrate the ability of the assay to detect zoonotic influenza viruses with pandemic potential. Analytical performance of the xTAG RVP was evaluated by testing serial dilutions of RNA extracted from grown influenza reference viruses of swine and avian origin belonging to Eurasian or North American lineages. All RNA dilutions were tested in duplicate by xTAG RVP and analyzed by TDAS-RVP software. The limit of detection of an RVP assay target was determined to be the lowest RNA concentration where two reactions were both positive. Highly pathogenic avian A(H5N1) viruses of clades 1, 2.1, 2.2, 2.2.1, 2.3.2, 2.3.4, and 7 were identified as influenza type A and subtype H5 at RNA concentrations equivalent to 102.2 to 104.1 infectious units. Viruses of clades 2.1.3, 2.1.3.1, 2.3.2.1, and 2.3.4 demonstrated variable reactivity with FluA and/or H5 targets and were often not identified correctly even at RNA concentrations equivalent to 109.2 to 109.5 infectious units. Other avian influenza A subtypes including H6 (Eurasian lineage), and H9 (clade B Y280, clade G1) and North American A(H7N3) were identified as influenza type A at low RNA concentrations. However, avian A(H7N9) viruses recently identified in humans in China were negative for influenza A at all concentrations tested. The xTAG RVP identified A(H1N2) human-origin influenza virus as influenza A subtype H1 virus at low RNA concentrations. A(H3N2) (v) viruses were identified as seasonal influenza A subtype H3 viruses at high concentrations of RNA only, while lower concentrations were identified as influenza A only. Our analytical performance evaluation showed that the xTAG RVP’s demonstrated variable ability to detect zoonotic influenza viruses with pandemic potential. Most non-human influenza A viruses tested here were identified as “unsubtypable” influenza type A. Importantly, A(H7N9) and some avian A(H5N1) viruses were not detected at any concentration tested. These results emphasize the need to consider alternative testing methods for specimens from suspect human cases of influenza viruses of pandemic potential, particularly A(H5N1) and A(H7N9) influenza. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L2 L E C TU R E A BSTRAC TS SPA102 OMEGA A review of the link between influenza and non-communicable diseases Palache, Abraham Mozes (1); Tainijoki-Seyer, Dr. Julia (2) 1: IFPMA, Switzerland; 2: The World Medical Association, France Background Approximately 5-10% of adults and 20-30% of children will contract seasonal influenza annually resulting in about 5 million severe cases and 500,000 deaths. Influenza in persons with non-communicable diseases (NCDs) can increase the risk of long-term exacerbation of chronic conditions, hospitalization, and death. Diabetes increases the risk of hospitalization from influenza three-fold. Heart attacks are 5 times more likely in persons with cardiovascular disease, and stroke is 3 times more likely in the 3 days following systemic respiratory infection. Case fatality rates from influenza A for persons with chronic obstructive pulmonary disease can be 30% or more, compared to 0.1% or less in the healthy. Since NCDs account for 63% of the annual global mortality, and 84% of these deaths are caused by cardiovascular disease (48%), cancer (21%), respiratory disease (12%), and diabetes (3%), the World Health Organization recommends influenza vaccination for people living with NCDs to reduce the consequent complications, hospitalizations and deaths. We reviewed the best available evidence of the impact of influenza vaccination on complications, hospitalizations and deaths from NCDs. Methods A search of the literature was conducted for quantifiable impacts of influenza immunization on deaths, hospitalizations, and complications from non-communicable diseases. The search was limited to the impacts of influenza vaccination on diabetes, heart attack, stroke and respiratory disease, leading causes of mortality from non-communicable diseases. Results Influenza increases the risk of deaths, hospitalization and complications in diabetes, heart disease, stroke, and respiratory disease. In diabetics, Influenza vaccination was found to reduce the risk of death from all causes by 28%. Furthermore, influenza vaccination in persons with diabetes reduced the risk of hospitalization during influenza epidemics by 79%. In a meta-analysis of randomized control trials, the risk of heart attack was shown to be reduced by over 50% in persons at high risk for cardiovascular disease who received influenza vaccination compared to placebo or other control groups. The risk of stroke was reduced by 24% in the vaccinated compared to controls. Influenza vaccination has also been shown to prevent exacerbations of chronic respiratory conditions. Conclusions: Vaccination against influenza has the potential to significantly improve public health, particularly in people living with NCDs. Our review indicates that influenza vaccination can prevent not only the infection caused by the flu virus, but also the complications from cardio-vascular diseases, such as heart attack and stroke, and from respiratory diseases and diabetes. Our findings support the WHO recommendation to provide vaccinations against seasonal influenza to all persons with NCDs and encourage the full implementation of this recommendation. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L3 L E C TU R E A BSTRAC TS SPA103 OMEGA Influenza B disease burden in general population in France. Results of the IBVD retrospective study from 2003 to 2014 Cohen, Jean Marie (1,2); Daviaud, Isabelle (1,2); Debost, Emmanuel (2); Valette, Martine (3); Enouf, Vincent (4); Mosnier, Anne (1,2) 1: Open Rome, France; 2: Réseau des Grog, France; 3: NRC influenza, Lyon; 4: NRC influenza, Paris Background If much attention has been paid to the flu over the past three decades, few studies have focused specifically on influenza B. Although, two distinct lineages (Yamagata and Victoria) operate alternately or simultaneously since 1997, leading to some “misadequation” of B vaccine strain. In France, since 1984, part of the influenza surveillance is performed by the Regional Groups for Influenza Observation network (Réseau des GROG), based on general practitioners and paediatricians weekly describing the intensity of their activity and swabbing part of their patients consulting for acute respiratory infection (ARI). Demographical, clinical and virological data are collected in a centralized data base called Vircases. The IBVD (Influenza B in Vircases Database study IBVD - funded by GSK) was launched with the purpose of describing the circulation and the burden of influenza B, from the 2003-2004 to the 2012-2013 influenza season in France. Data of the declining 2013-2014 influenza season will be added to this database. Methods The project is based on routine influenza surveillance data collected since 2003 at national level by the GROG network in France. Every patient consulting a GROG practitioner for an ARI and whose rhino-pharyngeal swab has confirmed the presence of any influenza virus, is included. We performed a retrospective descriptive analysis of the 2003-2013 influenza cases included in Vircases and will complete this analysis with 2013-2014 data. Results and discussion This powerful data base leads to get a comprehensive picture of influenza B disease burden for the period 20032014. Between 2003 and 2013, IBVD study is based on 16,335 virologically confirmed influenza cases, including 3,859 influenza B cases (23.6 %). Among the 2,266 B virus whose lineage is known, 1,422 (62.8%) belonged to the Yamagata lineage and 844 (37.2 %) to the Victoria lineage. Significant influenza B circulation with vaccine “misadequation” was observed in three seasons (2005-2006, 2007-2008 and 2008- 2009). Although considered as not very problematic, notably because without pandemic potential, influenza B circulated with a significant impact (estimated number of cases ≥ 1 million of the French population) during six of the ten seasons. The number of influenza B detections was higher than the one of A (H3N2) or A(H1N1) in three seasons (2005-2006, 2010-2011 and 2012-2013). The impact of seasonal circulation of influenza B was significant and highly variable: between 2003 and 2013, it is estimated that 20.5 million people (nearly one in three French people) have consulted a primary care practitioner for an ARI due to influenza B. Particularly common in 5-14 years old children, influenza B also concerns other age groups, especially the frail elderly (≥ 65 years old). Depending on the season and vaccine matching, elderly represent up to 11.7 % of influenza B cases. Paper Keywords: Influenza B; influenza B lineage; disease burden; primary care; France Conflicts of Interest: Presented study has been funded by GSK TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L4 L E C TU R E A BSTRAC TS SPA104 OMEGA Severity related factors in patients with severe acute respiratory infections (SARI): results from the Belgium SARI surveillance during the Influenza season 2012-2013 Nathalie Bossuyt (1), Anneleen Hombrouck (2), Isabelle Thomas (2), Françoise Wuillaume (1), Viviane Van Casteren (1), Steven Van Gucht (2) , the Belgian Network of sentinel general practitioners, the Belgian Network of sentinel hospitals, Sophie Quoilin (1) 1: Scientific Institute of Public Health, Operational Directorate of Public Health and Surveillance, Brussels, Belgium 2: Scientific Institute of Public Health, Operational Directorate of Communicable and Infectious Diseases, Viral Diseases, Brussels, Belgium Background In order to provide an early estimation of the severity of the seasonal flu epidemic, sentinel SARI surveillance was implemented in Belgium in 2011. The aim of the current analysis is to describe the SARI infections in season 20122013 in terms of severity and to provide insight in the association of characteristics of patient and pathogen with severity and mortality. Methods Six general hospitals (including emergency departments, intensive care units (ICU) and pediatric, internal medicine and geriatric wards) participated in the surveillance. Around the 2012-2013 influenza epidemic in Belgium (2012w51 - 2013w19), data were collected for all patients with an acute respiratory illness with onset within the last 7 days of (history of or measured) fever of ≥ 38°C and cough or dyspnoea (shortness of breath or difficulty to breath) and requiring hospitalisation (≥24). For each patient a respiratory swab was tested on influenza and other respiratory viruses by the National Reference Centre Influenza. An infection was defined severe if the patient either stayed on ICU, required invasive respiratory assistance or ECMO, developed ARDS or died. The association between severity and mortality and patient or pathogen characteristics was estimated using multivariable logistic regression models with severity/mortality as outcome and agegroup, sex, comorbidities, seasonal vaccination status, influenza test result, other respiratory viruses test result and month as linear predictors. Results The surveillance included 990 SARI cases in season 2012-2013, among which 148 (15%) severe cases: 11% ICU, 7 % invasive respiratory assistance, 6 % ARDS, 0% ECMO and 4% mortality (N=40). Among all patients severity was positively related to age (OR for respectively agegroups 15-44y 45-65y, 65-84y and ≥84y vs 0-4y: 3.73 (95%CI: 1.698.22), 3.86 (95%CI: 1.85-8.04), 3.51 (95%CI: 1.71-7.24) and 2.54 (95%CI: 1.05-6.13)), having a comorbidity (OR: 3.63 (95%CI: 1.93-6.81)), having cardiovascular comorbidity (OR: 1.75 (95%CI: 1.07-2.86)) and negatively to a confirmed influenza diagnosis (OR: 0.66 (95%CI: 0.44-1.00)). Mortality was positively related to age (OR for respectively agegroups 45-65y, 65-84y and ≥84y vs 0-4y: 4.86 (95%CI: 1.07,22.1), 6.55 (95%CI: 1.67-25.7) and 9.45 (95%CI: 2.08,43.0)), having at least 1 comorbidity (OR: 4.82 (95%CI: 1.02-22.7)) and negatively to respiratory comorbidity (OR: 0.28 (95%CI: 0.09-0.87)). Among the subset of laboratory confirmed influenza cases, patients having renal (OR: 8.03 (95%CI: 1.36,47.4)) or cardiovascular comorbidity (OR: 6.77 (95%CI: 1.25-36.8)) were at higher risk of dying. No relation between either severity or mortality and subtype (B, H1N1 or H3N2) could be found. Conclusions The first analysis of factors contributing to severity in SARI patients revealed that patient characteristics (age and (cardiovascular) comorbidity) rather than characteristics of the pathogen were associated with severity. Analysis of further seasons is necessary to corroborate these results. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L5 L E C TU R E A BSTRAC TS SPB1: VIRUS STRUCTURE AND REPLICATION SPB101 ALFA The novel functional site in the PB2 subunit of RNA-dependent RNA polymerase essential for acetyl-CoA interaction, RNA polymerase activity and viral replication Hatakeyama, Dai (1); Shoji, Masaki (1); Yamayoshi, Seiya (2); Hirota, Takenori (1); Nagae, Monami (1); Yanagisawa, Shin (1); Kawaoka, Yoshihiro (2); Kuzuhara, Takashi (1) 1: Tokushima Bunri University, Japan; 2: University of Tokyo, Japan Background Influenza A is still considered a serious global health issue. To combat the influenza A virus, neuraminidase inhibitors are widely used as antiviral drugs. However, since the viral neuraminidase gene mutates easily, many strains were found to be resistant to these drugs. Therefore, the identification of novel target molecules is required to develop antiviral therapies. Viral RNA-dependent RNA polymerase (RdRp), which is constructed by the PA, PB1 and PB2 subunits, is a promising target in the development of antiviral drugs. This RdRp is essential for viral transcription and replication. PB2 subunit binds to the host RNA cap (m7GTP) and supports the endonuclease activity of PA to “snatch” the cap from host pre-mRNAs. However, the structure of PB2 is not fully understood, and the functional sites remain unknown. In this study, we found that the Val/Arg/Gly (VRG) site in PB2 required for acetyl-CoA interaction, RNA polymerase activity of viral RdRp and viral growth. Methods (1) We performed series of biochemical experiments using wild-type and mutant recombinant proteins of PB2. The mutant PB2 contained amino-acid substitutions in the VRG site. (2) RNA polymerase activities of wild-type and mutant PB2 were measured by luciferase assays and strand-specific qRT-PCR. (3) Effects of VRG site amino-acid mutations on viral growth were investigated using wild-type and mutant recombinant viruses. Results In-vitro experiments using radioisotope-marked acetyl-CoA revealed that the recombinant PB2 cap-binding domain that includes the VRG site interacts with acetyl-CoA; moreover, it was found that this interaction could be blocked by excess amount of CoA and various HAT inhibitors, epigallocatechin gallate, curcumin, anacardic acid and garcinol. Interestingly, m7GTP also inhibited this interaction, suggesting that the same active pocket is capable of interacting with acetyl-CoA and m7GTP in a number of ways. To elucidate the importance of the VRG site on PB2 function and viral replication, we constructed a PB2 recombinant proteins and recombinant viruses including several patterns of amino-acid mutations in the VRG site. Substitutions of the valine and arginine residues or of all 3 residues of the VRG site to alanine did not affect binding abilities of m7GTP, but significantly reduced PB2’s binding ability to acetylCoA and its RNA polymerase activity. Strand-specific qRT-PCR showed that mRNA levels specifically decreased by point mutations in the VRG site, suggesting that this site plays crucial roles in transcriptional activity. Recombinant viruses containing the same mutations could not be replicated in cultured cells. Conclusion These results indicate that the VRG site in PB2 is a functional site that is essential for acetyl-CoA interaction, RNA polymerase activity and viral replication. This is the first report to identify a new functional site that is required for replication of the influenza virus. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L6 L E C TU R E A BSTRAC TS SPB102 ALFA Role of segment-specific genome packaging signals in genetic reassortment of influenza A viruses Isel, Catherine (1); Essere, Boris (2); Yver, Matthieu (2); Gavazzi, Cyrille (1); Terrier, Olivier (2); Fournier, Emilie (1); Giroux, Fabienne (2); Textoris, Julien (3); Julien, Thomas (2,4); Socratous, Clio (2); Rosa-Calatrava, Manuel (2,4); Lina, Bruno (2,5); Marquet, Roland (1); Moulès, Vincent (2,4) 1: Architecture et Réactivité de l’ARN, Université de Strasbourg, CNRS, IBMC, 15 rue René Descartes, 67084 Strasbourg, France; 2: Virologie et Pathologie Humaine, Université Lyon 1, EA4610, Faculté de Médecine RTH Laennec, 69008 Lyon, France; 3: Unité de Recherche sur les Maladies Infectieuses et Emergentes, Centre National de la Recherche Scientifique Unité Mixte de Recherche 7278, Institut National de la Santé et de la Recherche Médicale U1095, Faculté de Médecine Timone, Université Aix-Marsei; 4: VirNext, Université Lyon 1, EA4610, Faculté de Médecine RTH Laennec, 69008 Lyon, France; 5: Laboratoire de Virologie Est, Centre de Biologie et de Pathologie Est, Hospices Civils de Lyon,69677 Bron Cedex, France The segmented nature of the genome of influenza A viruses (IAVs) complicates virion assembly as IAVs must incorporate at least one copy of each vRNA to be infectious but allows the virus to rapidly evolve by genetic reassortment. We recently showed, for a human H3N2 virus, that the 8 viral ribonucleoproteins are interconnected, that each vRNA interacts with at least one other partner in vitro and that the regions involved in several of these interactions match known packaging signals. We also showed that the interactions formed by the vRNAs of an avian H5N2 IAV are different and involve sequences not previously recognized as packaging signals. Importantly, we demonstrated that a vRNA/vRNA interaction identified in vitro is crucial for optimal viral replication of the avian H5BN2 virus and for the selective co-packaging of the interacting vRNAs. A selective incorporation model of IAV vRNAs has important implications for genetic reassortment and for the design and production of vaccines. However, although genetic reassortment is clearly not random, little is known about the rules underlying this process. Genetic reassortment is limited by incompatibilities at the protein level but nothing was known about possible incompatibilities between vRNAs from different IAVs. We postulated that vRNA/vRNA interactions not only govern packaging, but also genetic reassortment. To investigate this hypothesis, we studied genetic reassortment between the human H3N2 and the avian H5N2 viruses, focusing our interest on reassortant viruses that bear the avian H5 HA segment. We found that only a limited subset of all the possible genotypes containing the H5 HA gene were produced. Importantly, the wild type H5 HA gene never entered the human genetic background alone but was always accompanied by the avian PA and M segments. Furthermore, introduction of the 5’ and 3’ packaging sequences of the H3 HA gene into an otherwise avian HA backbone allowed efficient incorporation of the chimerical HA vRNA into the human genetic background, suggesting that packaging signals are important for genetic reassortment. Accordingly, we showed that forcing the incorporation of the avian M segment into the human genetic background was sufficient to drive coincorporation of the H5 HA segment. Finally, introducing five silent point mutations into the 3’ packaging region of the human M segment was sufficient to drive incorporation of the H5 HA segment into the human genetic background during in vitro co-infections, and to affect the genotype of reassortant viruses. Altogether, these results indicate that suboptimal compatibility between the vRNA packaging signals limit genetic reassortment. Interestingly, the 3’ region of the human M segment, which drives co-incorporation of the H5 HA segment, has been shown to mediate interaction between the human HA and M vRNAs in vitro, suggesting a role for intermolecular vRNA/vRNA interactions in genetic reassortment. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L7 L E C TU R E A BSTRAC TS SPB103 ALFA Assembly of Influenza virus particles: Signals for targeting of HA and M2 to the budding site Veit, Michael (1); Brett, Katharina (1); Kordyukova, Larisa (2); Serebryakova, Marina (2); Siche, Stefanie (1); Thaa, Bastian (1); deVries, Maren (1); Herrmann, Andreas (3) 1: Free University Berlin, Virology, Germany; 2: Lomonosov Moscow State University, Physico-Chemical Biology, Russia; 3: Humboldt University Berlin, Molecular Biophysics, Germany Background Influenza virus assembly occurs in nanodomains of the plasma membrane enriched in spingolipids and cholesterol (“rafts”). HA is supposed to target to rafts by acylation of three conserved cysteine residues located in its cytoplasmic tail and by the hydrophobic amino acids VIL in the outer part of the transmembrane region (TMR). M2 causes scission of virus particles by wedge-like insertion of an amphiphilic helix located in its cytoplasmic tail. The helix is palmitoylated and binds cholesterol, features that have been proposed to target M2 to the edge of the viral budozone. Methods We established Foerster Resonance Energy Transfer by Fluorescence Life-time Imaging Microscopy (FLIM-FRET), a method that measures close proximity of two fluorophores, to investigate assembly of virus particles in transfected cells. Targeting signals identified by FLIM-FRET were exchanged in the context of the viral genome to analyze their significance for virus replication. Mass spectrometry was used to identify fatty acid species bound to HA. Results We demonstrate that deletion of the two raft-targeting features of HA reduced raft association. In addition, exchange of VIL, but not of the acylation sites severely retards transport of HA through the Golgi. Recent data suggest that VIL may be part of a sequence motif that binds cholesterol. Using mass spectrometry of HA we demonstrate that a cysteine at the cytoplasmic border of the TMR is modified with stearate, while two cysteines in the cytoplasmic tail carry exclusively palmitates. Recent results show that the location of the cysteine rather than the sequence context determines whether palmitate or stearate are attached. We (and others) have shown that acylation of HA is essential for virus replication. Recombinant viruses (WSN strain) with single disrupted palmitoylation sites could not be rescued and deletion of the stearoylation site caused a growth defect. In contrast, both raft-targeting features in M2 affect association of the cytoplasmic tail with membranes, but are not required for association of M2 with the viral budozone and do not affect virus replication. Thus, M2 must associate with the viral assembly site by other means. Conclusions Enzymes for acylation of HA have not been identified, but DHHC-proteins are likely candidates. 23 different DHHCs with distinct, partly overlapping substrate specificities exist in mammalian cells, but only a few might catalyze acylation of HA. These DHHCs are promising drug candidates, since their inhibition might not compromise acylation of cellular proteins. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L8 L E C TU R E A BSTRAC TS SPB104 ALFA Conserved and host-specific features of influenza virion architecture Hutchinson, Edward; Charles, Philip; Hester, Svenja; Thomas, Benjamin; Trudgian, David; Martínez-Alonso, Mónica; Fodor, Ervin Sir William Dunn School of Pathology, University of Oxford, United Kingdom Background Viruses use virions to spread between hosts, and virion composition is therefore the primary determinant of viral transmissibility and immunogenicity. However, the virions of influenza and of many other viruses are complex and pleomorphic, which has made them difficult to analyse in detail. Methods Making use of recent developments in mass spectrometry, we identified and quantified the hundreds of viral and host-encoded proteins that make up the pleomorphic virions of influenza A and B viruses. By comparing different combinations of virus and host, we produced the first complete and quantified model of influenza virions. Results We identified a conserved influenza virion architecture which is maintained across diverse combinations of virus and host. This ‘core’ architecture includes substantial quantities of host proteins, most of which had not previously been identified in virions. It also includes NS1, a viral suppressor of immunity which has previously been considered non-structural but which we show to be stably associated with virions. We found that this conserved ‘core’ virion architecture was elaborated with abundant host-dependent features. As a result, influenza virions produced by mammalian and avian hosts have distinct protein compositions. Finally, we note that influenza virions share an underlying protein composition with the exosomes shed by uninfected cells. Conclusions Quantitative mass spectrometry allows detailed analysis even of complex, pleomorphic virions. In the case of influenza we show that the host plays a substantial role in shaping virion architecture, and suggest that this is because the virus has co-opted parts of the exosome assembly pathway for virion production. The host-dependent features of the virion mean that egg-grown vaccines have a different composition to the virions shed from mammalian cells, and suggest that virion architecture may change during pandemic emergence.15 SEPTEMBER 2014 TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L9 L E C TU R E A BSTRAC TS SPA2: EPIDEMICS AND PANDEMIC THREATS SPA201 OMEGA The Epidemiological Characteristics of Influenza B Compared to Influenza A: Results of the Global Influenza B Study Caini, Saverio (1); Huang, Sue (2); Ciblak, Meral Akçay (3); Schellevis, François (1); Plotkin, Stanley (4); Paget, John (1) 1: NIVEL, The Netherlands; 2: The WHO National Influenza Centre, Institute of Environmental Science and Research, New Zealand; 3: Istanbul University, Istanbul, Turkey; 4: University of Pennsylvania, Philadelphia, USA Background The Global Influenza B Study (GIBS) has collected epidemiological and virological data from influenza surveillance systems from twenty-six countries worldwide. The GIBS database includes 935,673 influenza cases collected between 2000 and 2013. Here we analyse: (1) the epidemiological impact of influenza B, (2) the age distribution of influenza B cases, (3) the proportion of influenza B over total influenza cases, and (4) the frequency of influenza B vaccine mismatches. Methods To assess the epidemiological impact of influenza B, we tested the correlation between the proportion of influenza cases due influenza B and the maximum value of the country-specific Z-score of weekly influenza-like illness (ILI) rate during the same season. The correlation was defined as strong (0.4-0.69), moderate (0.3-0.39), weak (0.20-0.29) or negligible (0.01-0.019). We tested whether the age distribution of influenza B cases differed compared to influenza A. Finally, we calculated the proportion of influenza B cases, the proportion of Victoria and Yamagata lineages in each country and season, and determined the frequency of influenza B vaccine mismatches. All analyses were performed overall and separately for countries situated in the Southern or Northern hemisphere or in the intertropical belt. Results The correlation between the proportion of influenza B and the maximum ILI-rate (Z-score) during the same season was -0.31 in Southern hemisphere (p=0.15), -0.09 in the inter-tropical belt (p=0.62), and -0.31 in the Northern hemisphere (p=0.03). Patients infected with influenza B were younger than influenza A patients; in particular, there was a consistently higher proportion of influenza B cases in the 5-17 age group and influenza A cases in the 18-64 years age group. Age differences were more evident in countries in Southern and Northern hemispheres and less evident in countries in the intertropical belt. The overall median proportion of influenza B over all influenza cases was 22.6% (inter-quartile range [IQR]: 8.3%-37.7%); it was 17.8% in the Southern hemisphere (IQR 3.5%-30.4%), 24.3% in the intertropical belt (IQR 10.2%-40.8%), and 21.4% in the Northern hemisphere (IQR 7.3%-38.0%). Victoria and Yamagata lineages predominated during 64% and 36% of seasons respectively. A vaccine mismatch was observed in 38% of seasons; this occurred more frequently in the Northern (50.0% of seasons) and Southern (46.2% of seasons) hemispheres, and less frequently in the intertropical belt (13.3% of seasons). Conclusions Influenza B accounted for roughly 20% of total influenza cases in all regions of the world during 2000-2013; it usually co-circulated with influenza A and was moderately correlated with lower ILI rates in the Northern and Southern Hemisphere. Influenza B was frequently associated with a vaccine mismatch and was more frequent in the young (5-17 years), with both of these findings being more evident in temperate zones. These findings are important for planning and implementing influenza control and prevention policies, especially vaccination campaigns, in the different regions of the world. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L10 L E C TU R E A BSTRAC TS SPA202 OMEGA Seasonal influenza in the WHO European Region: analysis of 2008-2013 influenza surveillance data in 48 countries Gefenaite, Giedre (1); Caini, Saverio (2); Gross, Diane (3); Meerhoff, Tamara (4); Pereyaslov, Dmitriy (3); Paget, John (2); Brown, Caroline Sarah (3) 1: Department of Pharmacoepidemiology & Pharmacoeconomics, University of Groningen, Groningen, the Netherlands; 2: Netherlands Institute for Health Services Research (NIVEL), Utrecht, the Netherlands; 3: WHO Regional Office for Europe, Denmark; 4: Department of Primary and Community Care, Radboud University Medical Centre, Nijmegen, the Netherlands Background Understanding the diversity of seasonal influenza activity across regions and over time is vital to developing effective preventive and control measures. In order to better understand seasonal influenza patterns in the WHO European Region, we assessed five consecutive influenza seasons. Methods Data on influenza seasons from 2008-2013 was obtained from the WHO Regional Office for Europe platform for Influenza Surveillance (EuroFlu), which contains surveillance data from 48 Member States. Countries were included in the analysis if their weekly laboratory-confirmed influenza, influenza-like illness (ILI), or acute respiratory infections (ARI) data were reported for 20 consecutive weeks between surveillance weeks 40 to 20, allowing one week of missing data. The laboratory-confirmed influenza median peak week and its interquartile range (IQR), length (weeks) and spread (Pearson’s correlation between peak week and latitude/longitude) were estimated for the Region, by influenza seasons, across six geographical sub-regions, and for influenza virus type. The influenza season length for each country was defined as the period between the first and last week with 5% of laboratory-confirmed influenza cases that season, The influenza peak activity was correlated with the latitude and longitude of the middle of each country. Statistical analysis was performed with one-way ANOVA, t-test and nonparametric median test using SPSS 20.0.0.2. The 2009/2010 pandemic season was excluded from the pooled seasonal influenza analysis. A p-value <0.05 indicated statistical significance. Results Excluding the 2009/2010 pandemic season, the length of the influenza season was similar in countries throughout the Region and averaged approximately 8.9 weeks (SD 3.6), with no significant variation between sub-regions, influenza seasons or influenza virus type. Seasonal influenza activity based on laboratory-confirmed influenza usually peaked in countries between weeks 4 and 9, but peaks were different between sub-regions(p-value < 0.05), first peaking in week 5 in northern and western Europe and central Asia, and last in eastern Europe in week 8. There was west to east spread in 2008/2009, 2010/2011 and 2012/2013 influenza seasons, and south to north spread in 2011/2012 season (Table 1). During the pandemic, influenza peaked in week 47 and it lasted about approximately 7.5 weeks (SD=4.1). The pandemic season’s length was not significantly different from the other years or between sub-regions, but there was evidence for moderate west to east spread (R2=0.33, p-value >0.5). Discussion From 2008-2013, the length of the influenza season was similar across the Region typically lasted for about nine weeks independent of the sub-region, but it was rather diverse in its timing. There was also evidence of west to east spread of influenza. These results might be used to strengthen public health action plans related to influenza preparedness, and, particularly in severe seasons, to share experience between first-affected countries and those not yet experiencing peak influenza activity. Keyword Influenza, WHO European Region, Peak activity, Duration TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L11 L E C TU R E A BSTRAC TS Fig. 1. Sub-regions of the WHO European Region. Fig. 1. Sub-regions of the WHO European Region Subregions Central Asia Eastern Europe Northern Europe Southern Europe West Asia Western Europe Table 1. Median influenza peak activity, mean season length, and spread by season based on the laboratoryconfirmed influenza between 2008/2009 and 2012/2013. W-E: west to east spread; S-N: south to north spread; *p-value <0.05; **p-value <0.01; IQR: interquartile range Season N Median peak activity Mean season length week (IQR) weeks (SD) W-E (R2) S-N (R2) 2008/2009 38 4 (3-9) 8.42 (4.42) 0.69** -0.16 2009/2010 50 47 (46-48) 7.56 (4.13) 0.33* 0.02 4 2010/2011 47 4 (3-7) 8.96 (3.43) 0.37* -0.14 2011/2012 52 9 (6-11) 8.75 (4.12) 0.10 0.33* 2012/2013 54 6.5 (5-9) 9.59 (2.40) 0.31* -0.15 TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L12 L E C TU R E A BSTRAC TS SPA203 OMEGA Effectiveness of closure of live poultry markets in reducing influenza A(H7N9) transmission during the 2013-14 winter wave Wu, P (1); Jiang, H (2); Wu, JT (1); Chen, E (3); He, J (4); Zhou, H (2); Wei, L (1); Yang, J (2); Yang, B (1); Qin, Y (2); Fang, VJ (1); Li, M (2); Tsang, TK (1); Zheng, J (2); Lau, EHY (1); Cao, Y (2); Chai, C (3); Zhong, H (4); Li, Z (2); Leung, GM (1); Feng, L (2); Gao, GF (5,6); Cowling, BJ (1); Yu, H (2) 1: School of Public Health, The University of Hong Kong, Hong Kong S.A.R. (China); 2: Division of Infectious Disease, Key Laboratory of Surveillance and Early-warning on Infectious Disease, Chinese Center for Disease Control and Prevention, Beijing, China; 3: Zhejiang Provincial Centre for Disease Control and Prevention, Hangzhou, Zhejiang Province, China.; 4: Guangdong Provincial Centre for Disease Control and Prevention, Guangzhou, Guangdong Province, China; 5: CAS Key Laboratory of Pathogenic Microbiology and Immunology, Institute of Microbiology, Chinese Academy of Sciences, Beijing, China; 6: Office of Director-General, Chinese Center for Disease Control and Prevention, Beijing, China Background The novel avian influenza A(H7N9) virus has caused two epidemic waves in mainland China during 2013-2014 since it was first identified in March 2013, with 417 laboratory-confirmed human cases reported by 28 April 2014. Temporary closure of live poultry markets was suggested to be highly effective in reducing in the incidence of H7N9 infections in a few major cities involved in the 2013 spring wave. This study aims to estimate the impact of market closure in reducing risk of human infections during the 2013-14 winter wave. Methods Nine urban areas in the two most affected provinces in the 2013-14 winter wave were selected for the study. The ratio of the estimated incidence rates of H7N9 virus infection during versus prior to LPM closure from the model indicated the effectiveness of intervention by assuming a constant incidence rate of infection before and during the market closure and a lognormal distribution of the incubation period of the H7N9 infection. An overall model combining data from all selected areas was also fitted assuming the same incidence rate ratio across all areas. Results Point estimates of the effectiveness of LPM closure varied from 61-89% in the nine areas with generally wide credibility intervals while the effectiveness was estimated to be 97% (95%CI: 89%, 100%) in the overall model. The incubation period distribution has a mean 3.4 days (95% CI: 2.2-5.0). Conclusions Our analysis found that live poultry market closure was highly effective in reducing the risk of human infections with H7N9 virus during the 2013-14 winter wave, similar to the estimates from the study on the 2013 spring wave. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L13 L E C TU R E A BSTRAC TS SPA204 OMEGA Molecular determinants of influenza A/H7N9 virus HA receptor binding and stability Schrauwen, Eefje J.A. (1); Richard, Mathilde (1); Herfst, Sander (1); Bestebroer, Theo (1); Lexmond, Pascal (1); Burke, David F. (2); Rimmelzwaan, Guus F. (1); Osterhaus, Albert D.M.E. (1); Fouchier, Ron A.M. (1) 1: ErasmusMC, Rotterdam, Netherlands The; 2: University of Cambridge, Cambridge, United Kingdom Background In the spring of 2013, an avian origin A/H7N9 influenza virus emerged in Eastern China and was transmitted to humans. These human infections are believed to have resulted from exposure to infected poultry. Although A/H7N9 viruses harbor genetic traits associated with adaptation of avian viruses to humans and increased transmission between mammals, no sustained human-to-human transmission has been reported. Several studies have shown that transmission of A/H7N9 viruses via the airborne route (respiratory droplets and aerosols) between ferrets was limited, suggesting that A/H7N9 viruses still lack crucial determinants for airborne transmission (e.g. Richard et al., Nature 501:560-3, 2013). Receptor specificity and stability of the hemagglutinin (HA) are thought to contribute substantially to airborne transmission of influenza viruses. Methods Amino acid substitutions that are known to affect receptor binding and stability were investigated in the context of the A/Anhui/1/13 HA in vitro. Using a model of the trimeric structure of the H7 HA, additional amino acid substitutions that might affect stability were predicted and investigated. To address the question whether this virus could acquire other determinants for adaptation to mammals, A/Anhui/1/13 wild type virus and A/Anhui/1/13 virus containing a G219S substitution in the receptor binding site of HA (G228S in H3 numbering), were passaged in the upper respiratory tract (URT) of ferrets. Results The HA of A/Anhui/1/13 with the G219S substitution in the receptor binding site displayed a change in receptor affinity towards increased human receptor preference. However, this H7 with G219S displayed a decrease in temperature and acid stability. A substitution known to stabilize the H5 HA (K58I in HA2), increased the temperature and acid stability of H7 with G219S. Another amino acid substitution, which was found during the earlier ferret transmission experiments with the A/Anhui/1/13 isolate (A210E) was also found to increase the acid and temperature stability of HA. Surprisingly, A/Anhui/1/13 and A/Anhui/1/13 with G219S acquired only a few amino acid substitutions in HA after passage in the URT of ferrets. Conclusions Here, we showed that a switch towards increased human receptor specificity coincided with a decrease in stability of HA of A/H7N9 virus. These results are in line with what has been recently shown for airborne transmissible H5N1 virus, for which increased human receptor specificity also coincided with decreased stability of the HA. For the H5N1 virus, an increase in stability was required for the virus to be transmitted via the airborne route. Here, several amino acid substitutions in the hemagglutin had the ability to restore the stability of HA of A/Anhui/1/13 with a G219S mutation. These results could help identifying amino acid substitutions which alter the hemagglutinin stability and binding preference, properties that have been shown to influence airborne transmission. Therefore these results provide essential information for the surveillance and assessment of the pandemic potential of currently circulating H7N9 viruses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L14 L E C TU R E A BSTRAC TS SPB2: VIRAL FACTORS IN PATHOGENESIS SPB201 ALFA The Epidemiological Characteristics of Influenza B Compared to Influenza A: Results of the Global Influenza B Study Baumann, Jan; Monougu, Nancy; Klenk, Hans Dieter; Matrosovich, Mikhail Philipps University Marburg, Germany, Germany Background The repeated introduction of influenza A viruses of wild aquatic birds into land-based birds and mammals emphasizes the need to determine viral properties which contribute to interspecies transmission. Alteration of the receptorbinding specificity of the viral hemagglutinin (HA) is known to be essential for the avian-to-mammalian adaptation. Less is known about potential host-specific differences in the membrane fusion activity of the HA and their role in interspecies transmission. We addressed these questions by comparing fusogenic properties of phylogenetically related H1N1 influenza viruses isolated from wild aquatic birds, pigs, and humans. Materials and methods To analyze pH dependency of viral cell entry we studied neutralization of viral infectivity in MDCK cells by lysosomotropic agent ammonium chloride, which interferes with endosomal acidification. Hemolysis assay was used to determine HA-mediated membrane fusion activity of the viruses. Viral stability at low pH was assessed by incubating viruses in buffers with pH values from 5.0 to 7.0 followed by titration of remaining infectivity in MDCK cells. The effects of amino acid substitutions on the HA fusion activity was studied using the plasmid encoded HA gene of A/dk/Bavaria/1/77 (H1N1) virus modified by site directed mutagenesis. The modified HAs were expressed in HeLa cells, and polykaryon formation was determined after incubation at low pH. Results Swine viruses were less sensitive to neutralization by ammonium chloride than avian and human viruses (IC50% of NH4Cl: 1.5- 2.5 mM for swine viruses and 0.6-1.0 mM for avian and human viruses). This finding suggests that swine viruses can fuse with endosomal membranes and enter the cells at a higher pH. Indeed, the pH optimum of the viral hemolytic activity was found to be 0.2 to 0.5 units higher in the case of swine viruses than in the cases of avian and human viruses. Accordingly, swine viruses were more sensitive than avian and human viruses to inactivation under low pH conditions. To identify amino acids responsible for the observed differences between Eurasian avian-like swine viruses and their putative avian precursors, we compared viral HA sequences and found eight host-specific amino acid differences. We introduced the swine-virus-like amino acids into an avian HA, assayed membrane fusion activity of the HA variants and found that substitutions T393S and S457F raised the pH of HA-mediated fusion of the avian HA by 0.2 pH units. Conclusion Because avian and human H1N1 viruses have a lower pH optimum of membrane fusion activity and are more stable than closely related porcine viruses, we assume that fusion-related characteristics of the HA represent a host-range factor restricting avian-to-swine and swine-to-human transmission of influenza viruses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L15 L E C TU R E A BSTRAC TS SPB202 ALFA Single cell analysis reveals strain-specific inhibition of ISG-expression by the viral NS1 protein in influenza A virus infected cells von Recum, Jessica; Weinheimer, Viola K; Wolff, Thorsten Div of Influenza Viruses and Other Respiratory Viruses, Robert Koch Institut,Berlin, Germany Background Influenza A virus (IAV) infection provokes an antiviral immune response including activation of interferon (IFN) and IFN-stimulated genes like ISG15 but the spatio- temporal spread of this alarm response throughout a tissue or culture is not very well understood. The aim of this study was to elucidate the expression patterns of ISGs and viral antigen in infected vs. non-infected cells within the same culture and to determine viral and cellular factors involved in this process. Methods In order to assess the induction and distribution of the antiviral IFN response in single cells within an IAV infected cell culture we devised a FACS-based assay enabling simultaneous viral antigen and ISG detection. Further approaches involved the use of small molecule inhibitors targeting relevant signaling pathways, transfection-based reporter assays to identify viral regulatory factor(s), as well as GST pulldown assays and reverse genetic analysis. Results Analysis of human cell cultures infected with seasonal H3N2 and H1N1 IAV revealed an unexpected distinction of cell populations expressing either viral antigen or ISG15, but not both. This bisection was robustly observed across a number of experimental variations including doses and time-points of infection indicating ISG upregulation in noninfected, but not in infected cells. Interestingly, the proportion of infected cells that were also ISG15-positive was significantly increased upon infections with low- pathogenic avian IAV or the emerging avian-origin H7N9 IAV in comparison to seasonal IAV, indicating that these non-human-adapted viruses are debilitated in ISG15 suppression. A seasonal mutant virus lacking the NS1 gene increased the percentage of infected ISG15-positive cells up to 6 times indicating a role for NS1 in inhibiting ISG15-expression in infected cells. In contrast, NS1-deficiency barely affected the proportions of non-infected ISG expressing cells despite of strongly increased type I and III IFN induction. This finding illustrates that NS1 reduces ISG induction primarily in infected cells, but hardly affects ISG levels in neighbouring cells. Transfection-based experiments confirmed that NS1 of seasonal IAV strongly reduced IFNstimulated ISG15-induction whereas this was not observed for NS1 of avian IAV or H7N9. Sequence comparisons revealed that NS1 proteins unable to suppress ISG15 had amino acid changes related to the loss of binding to the polyadenylation factor CPSF30. In fact, reverse genetic analysis of viral NS1 proteins showed a direct correlation between CPSF30 binding and suppression of ISG15, MxA and ISG56 expression in infected cells. Conclusions Single cell analyses revealed an unexpected restriction of ISG suppression by NS1 proteins of seasonal IAV to infected cells that correlates with their ability to bind CPSF30. The data not only provide insights into the ways IAV counteract the IFN response in infected cells, but also implicate that even NS1-expressing IAV strains face substantial ISG induction in neighbouring cells during multicycle replication. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L16 L E C TU R E A BSTRAC TS SPB203 ALFA Neuraminidase-negative avian influenza viruses of subtype H5 and H7: Variation of virulence in the chicken model Hoffmann, Donata (1); Röhrs, Susanne (1); Bogs, Jessica (1); Stech, Jürgen (2); Beer, Martin (1) 1: Institute of Diagnostic Virology, Friedrich-Loeffler-Institut, Greifswald - Insel Riems, Germany; 2: Institute of Molecular Virology and Cell Biology, Friedrich-Loeffler-Institut, Greifswald - Insel Riems, Germany Background A neuraminidase (NA)-negative virus originating from highly pathogenic avian influenza virus of subtype H5 (EscEgg50A; H5NAneg) was recently characterized as replication competent in vitro and highly attenuated in adult chicken (Kalthoff et al., 2013. J Virol. 87(24):13556-68). The suitability of the H5NAneg virus variant as a model for the induction of a very early onset of protection was demonstrated within the adult chicken, mouse and ferret model (Röhrs et al., 2014. Vaccine. 32(22):2631-6). Material and Methods The H5 of the EscEgg50 strain was exchanged by reverse genetics with H7 including a polybasic cleavage site resulting in strain H7NAneg. Both viruses were further evaluated in the chicken model using day-old chicks (H5NAneg) or 6 week-old adult chickens (H7NAneg). Results In contrast to the outcome with older chickens, day-old-chicks exhibited typical disease symptoms of highly pathogenic avian influenza infection after intramuscular as well as oronasal infection with H5NAneg (Fig 1A). The animals succumbed to the disease or had to be euthanized within 4 days (i.m. application) or 12 days (oronasal application). In-contact animals were also infected in both groups. Viral RNA loads from different tissues (e.g. myocard, lung, brain, skeletal muscle) confirmed a systemic infection. However, in one-week-old chickens inoculation with H5NAneg again did not result in clinical signs. Furthermore, adult chickens, intramuscularly inoculated with H7NAneg showed the typical clinical picture (Fig. 1B) of highly pathogenic avian influenza with 100% mortality until 4 days post inoculation. Transmission to sentinel chicken could be demonstrated in 2 out of 5 animals. Again, different organ samples scored positive for viral RNA, demonstrating severe systemic infection. Conclusions We evaluated the virulence of replication-competent NA-negative viruses in chickens of different ages. Interestingly, the virulence of H5NAneg is very much age-dependent. Day-old-chicks without maternally derived antibodies succumb to a systemic infection, while chickens one week of age do not show any clinical signs at all. Therefore, the day-old-chick organism is most likely not able to restrict replication of the virus as older chickens do. In addition to this host-derived component of virulence, our results from the H7NAneg inoculation experiment clearly demonstrated a hemagglutinin subtype-dependent variation in virulence despite using an identical genetic backbone. Inoculation with H7NAneg exhibited a highly pathogenic phenotype even in adult chickens, providing evidence, that the virulence of the H7 subtype might be less affected by the neuraminidase protein than that of the H5 virus. Our work with NA-negative avian influenza viruses provides a unique tool to study the role of the neuraminidase protein in replication cycle and pathogenesis of highly pathogenic avian influenza viruses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L17 L E C TU R E A BSTRAC TS Fig 1: Typical clinical signs (hemorrhages on the feet; lethargy) from (A) H5NAneg infected day-old-chicks, and (B) Fig 1: Typical clinical signs (hemorrhages on the feet; lethargy) from (A) H5NAneg H7NAneg-inoculated infected day-old-chicks, and (B)chicken H7NAneg-inoculated chicken TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L18 L E C TU R E A BSTRAC TS SPB204 ALFA Assessment of transmission, pathogenesis and adaptation of H2 subtype influenza viruses using the ferret model Claudia Pappas, Hua Yang, Hui Zeng, Paul J. Carney, James Stevens, Jacqueline M. Katz, and Terrence M. Tumpey. Influenza Division, National Center for Immunization and Respiratory Disease, Centers for Disease Control and Prevention, Atlanta, GA 30333, USA Background After their disappearance from the human population in 1968, influenza viruses of the H2 subtype have continued to circulate in the natural avian reservoir. In 2006, the sudden emergence of H2N3 subtype viruses in the swine population increased the awareness that H2 viruses still pose a threat to public health. These viruses contained a Q226L substitution in the hemagglutinin (HA) receptor binding site which is a key amino acid for specific binding to α2,6 sialic acid receptors found in mammalian cells. The present work evaluated the transmissibility and pathogenicity of H2 viruses isolated from avian, swine and human hosts using the ferret model. Methods For each experiment, ferrets were inoculated with either avian, swine or human viruses of the H2N2 or H2N3 subtypes. Clinical signs were monitored and replication of H2 viruses in ferret tissues was determined. Because the HA1 is important for recognition of sialic acid receptors and efficient transmission in mammals, we performed sequence analysis of the HA receptor binding region from infected ferret tissues to look for the presence of genetically distinct viral subpopulations. A detailed glycan array approach was also used to analyze the repertoire of sialylated glycans recognized by swine H2 virus. Results Results revealed that despite a low pathogenic phenotype, avian H2 viruses were able to replicate in the respiratory tracts of ferrets at different levels and could be transmitted between ferrets in the presence of direct contact, but not by respiratory droplets. Virus quasispecies were present in the nasal washes and tissues of ferrets, some containing amino acids mutations in the HA receptor binding region that included a Q226L substitution. Ferrets inoculated with swine H2N3 virus displayed greater clinical symptoms and higher infectious virus titers throughout the ferret respiratory tract when compared to human H2N2 virus-infected ferrets. Moreover, the swine H2N3 virus spread efficiently between cohoused ferrets, similar to that observed for human H2N2 viruses. Furthermore swine H2N3 virus possessed the capacity to be transmitted via respiratory droplets to 2 out of 3 ferrets, while a human H2N2 virus transmitted to 3 out of 3 ferrets. Glycan microarray analysis of the swine recombinant HA revealed a strong binding preference for the α2-6-linked sialosides and some binding to mixed α2-3/α2-6 branched sialosides. Conclusions The presence of leucine at position 226 in the HA suggests that following replication, H2 viruses have ability to mutate and adapt to mammals by altering their receptor binding specificity. Further studies are underway to characterize additional genetic mutations that confer host adaption of potentially pandemic H2 viruses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L19 L E C TU R E A BSTRAC TS SPA3: IMMUNOLOGY SPA301 OMEGA CD8+ T cells correlate with protection against symptomatic illness following natural pandemic influenza infection in humans Sridhar, Saranya (1); Begom, Shaima (1); Bermingham, Alison (2); Hoschler, Katja (2); Adamson, Walt (3); Carman, William (3); Bean, Thomas (4); Barclay, Wendy (1); Deeks, Jonathan (5); Lalvani, Ajit (1) 1: Imperial College London, United Kingdom; 2: Public Health England, Colindale, UK; 3: Glasgow University, UK; 4: Public Health England,Porton Down, UK; 5: University of Birmingham, UK Background Experimental challenge studies in humans lacking pre-existing antibodies demonstrated an inverse association for influenza-specific T-cells and symptomatic illness providing proof-of-concept for the protective capacity of T-cells against influenza-illness. Whether cross-reactive T-cells impact clinical outcomes of natural influenza infection remains unanswered. The 2009 pandemic provided a unique natural experiment to determine whether crossreactive cellular immunity is associated with limiting symptomatic illness following influenza infection in antibodynaive individuals. Methods We followed 342 healthy adults through the pandemic from 2009-11. We correlated pre-existing cellular immune responses to live pH1N1 virus and conserved CD8 T- cell epitopes from virus core proteins with clinical outcomes following incident pH1N1 infection. Results Individuals developing mild illness without fever (or cough or sore throat) had higher frequencies (p=0.04) of preexisting influenza-specific cross-reactive T-cells than those with symptoms or fever. Total symptom score inversely correlated with frequencies of pre-existing cross-reactive T-cells to pH1N1 virus (r=-0.39, p=0.05) and conserved CD8 epitopes (r=-0.5, p=0.01). Of three functional T-cell subsets, only IFN-γ+IL-2- T-cells were associated with limiting illness severity and viral shedding. Within this influenza-specific functional T-cell subset, CD8+ cells of late-effector CD45RA+CCR7- phenotype inversely correlated with symptom score (r=-0.49, p=0.02) and expressed CCR5 tissuehoming and CD107 degranulation markers on exposure to live virus. Conclusions In the absence of protective antibodies, cross-reactive CD8+ T-cells correlate with protection against symptomatic pandemic influenza. This immune correlate of protection could guide development and evaluation of T-cell-inducing influenza vaccines and inform vaccination policy. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L20 L E C TU R E A BSTRAC TS SPA302 OMEGA Exploring the humoral cross-reactome against the influenza virus surface glycoproteins proteins hemagglutinin and neuraminidase Krammer, Florian Icahn School of Medicine at Mount Sinai, United States of America Background Influenza viruses continue to be a major public health burden worldwide. In addition to seasonal influenza, zoonotic viruses pose a constant pandemic threat. Recently, it has been shown that natural infection with influenza viruses can induce antibodies against the major surface glycoprotein, the hemagglutinin, that are able to broadly neutralize different subtypes. However, it is unknown to which extend these cross-reactive antibodies are induced by natural infection with H1N1 or H3N2 in animal models and in humans, how prevalent they are in the population and how broad their reactivity is in terms of binding and neutralization. Furthermore, little is known about cross-reactivity for the second viral surface glycoprotein, the neuraminidase. Methods To recapitulate the human exposure to influenza viruses we sequentially infected mice with seasonal and pandemic H1N1 strains or with H3N2 viruses that are separated by 29 years of antigenic drift. Sera from these animals were than analyzed for binding to more than 30 different recombinant hemagglutinins including all 18 subtypes and many strains within subtypes by quantitative endpoint titer ELISA. Similarly, reactivity to all neuraminidase subtypes was tested. Importantly, all hemagglutinin and neuraminidase proteins used as substrate were expressed as trimers and tetramers respectively, folded correctly and fully functional. Results We found that animals sequentially infected with H1N1 strains developed broad reactivity against group 1 hemagglutinins and low reactivity to group 2 hemagglutinins suggesting the presence of group 1 specific stalkreactive antibodies. Interestingly, sera from H1N1 infected animals did not react with recombinant H3 proteins at all. Animals sequentially infected with H3N2 viruses developed broad reactivity to group 2 hemagglutinins but also reacted strongly to H2, H5 and H6 group 1 hemagglutinins in the absence of reactivity to H1. This suggests the presence of cross-reactive epitopes in the globular head domain of H2, H3, H5 and H6 hemagglutinins. The complete lack of H1-H3/H3-H1 cross-reactivity might also suggest that these viruses - which co-circulate in humans - have been under evolutionary pressure to exclude cross-reactive epitopes from their surface proteins. Cross-reactivity within neuraminidase subtypes was good but no reactivity across subtypes was detected. Conclusions We are now expanding our studies to guinea pigs, ferrets and humans and we are also exploring the functionality of these antibodies. The data generated will allow novel insights in circulation dynamics of seasonal influenza virus strains in the human population and will also help us to understand to which extend these crossreactive antibodies contribute to the species barrier that protects the human population from emerging zoonotic influenza viruses like H5N1 and H7N9. Finally, we believe that insights into the cross- reactome will further advance the development of universal influenza virus vaccines and antibody therapies. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L21 L E C TU R E A BSTRAC TS SPA303 OMEGA Polyclonal and Isotype-Specific Effects of Hemagglutinin Stalk-Mediated Neutralization Miller, Matthew S. Icahn School of Medicine at Mount Sinai, United States of America Background Broadly-neutralizing antibodies that bind to the hemagglutinin (HA) stalk domain have received substantial attention for their ability to provide potentially ‘universal’ protection against influenza A virus (IAV) infection. While considerable progress has been made in understanding the structure and function of monoclonal HA stalkbinding IgGs, little is known about how these antibodies behave in the context of a polyclonal response, or as other isotypes. This information will be essential in informing universal influenza virus vaccine design, and will advance comprehension of the complex interplay between the diverse antibody clonotypes elicited during natural humoral immune responses. Methods Polyclonal donor-matched IgG and IgA was purified from the serum of healthy adults. The functional activities of these antibodies were compared to well-characterized monoclonal antibodies with specificity for the HA head or stalk domain. VH and VL regions of monoclonal HA stalk binding antibodies were then cloned into chimeric human IgG or IgA backbones in order to assess how isotype affected antibody function. Results In a polyclonal context, the neutralizing potency of HA-stalk binding antibodies was markedly increased relative to that of antibodies that bind to the HA head domain. While serum-derived IgG and IgA were capable of neutralizing virus via the HA stalk domain to a similar extent, IgAs were comparably weaker in mediating HA head domainmediated neutralization. This was due to an isotype-specific bias, whereby IAV-specific IgA were most likely to be HA stalk-specific, whereas the majority of IgG was specific for the HA head domain. Furthermore, when expressing identical VH and VL regions, IgA was capable of neutralizing virus with superior potency relative to IgG. Taken together, these observations highlight an important role for IgA in contributing to HA stalk-mediated neutralization that should inform universal IAV vaccine design. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L22 L E C TU R E A BSTRAC TS SPA304 OMEGA Human cytotoxic T lymphocytes directed to influenza B viruses crossreact with viruses of two phylogenetic lineages Van De Sandt, Carolien E.; Dou, Yingying; Vogelzang-van Trierum, Stella E.; Westgeest, Kim B.; Osterhaus, Albert D.M.E.; Fouchier, Ron A.M.; Hillaire, Marine L.B.; Rimmelzwaan, Guus F. ErasmusMC, Netherlands, The Background Influenza virus infections are an important cause of respiratory tract infections worldwide. Seasonal influenza epidemics are caused by influenza type A and B viruses. The yearly return of these viruses can be attributed to their ability to evade the virus neutralizing antibody response by accumulating mutations in the hemagglutinin and neuraminidase. It has been shown that cytotoxic T lymphocytes (CTLs) directed against conserved internal proteins of influenza A viruses contribute to cross-protection against infection with antigenically distinct intrasubtypic and heterosubtipic variants. Influenza B viruses fall into two antigenically distinct lineages, namely the B/ Victoria/02/1987 and B/Yamagata/16/1986 lineage. It is unknown to what extent T cells directed to viruses of one lineage cross-react with viruses of the other lineage. Here, we assessed the cross- reactivity of CTLs with influenza B viruses of both lineages. Materials and Methods Influenza viruses B/Yamagata/16/1988, B/Victoria/02/1987 and two recent epidemic strains B/ Netherlands/712/2011 and B/Netherlands/455/2011 belonging to either lineage were propagated in MDCK cells and used in the present study. Amino acid sequence homology of the internal proteins was determined by BLAST analysis. Immune-epitope database and SYFPEITHI were used to predict putative epitopes shared by these viruses. Polyclonal CTL populations were obtained from HLA-typed donors after in vitro stimulation with influenza viruses B/Yamagata/16/1988 or B/Victoria/02/1987. The (cross-)reactivity of these CTLs with the respective viruses was assessed by determining IFN-γ production using intracellular cytokine staining and flowcytometry and their capacity to lyse MHC class I-matched cells infected with the respective viruses. Results Although the viral HA of these lineages is variable, the internal proteins were relatively conserved and several predicted epitopes were present in viruses of both lineages. This indicates the possibility of CTLs to cross-react between viruses of different lineages. Polyclonal CTL populations obtained after in vitro stimulation with influenza viruses B/Victoria/02/1987 or B/Yamagata/16/1988 displayed a high degree of cross-reactivity with drifted variants of the corresponding lineage or viruses of the heterologous lineage. Conclusions Thus, influenza B virus specific CTLs display a high degree of cross-reactivity and it is anticipated that these cells afford cross-protection against infection with drift variants of the homologous lineage or viruses of the alternate lineage. These findings may have implications for the development of vaccines that aim at the induction of broadly protective immunity based on cross-reactive T cell responses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L23 L E C TU R E A BSTRAC TS SPB3: MATHEMATICAL MODELING SPB301 ALFA The immune response and within-host emergence of pandemic influenza virus Reperant, Leslie (1); Kuiken, Thijs (1); Grenfell, Bryan (2); Osterhaus, Albert (1) 1: Erasmus Medical Centre, Netherlands, The; 2: Princeton University, USA Background Pandemic influenza viruses have emerged four times in the past hundred years. Their origins are zoonotic influenza viruses transmitted from animal reservoirs to humans, in which they have evolved to acquire efficient human-tohuman transmissibility. The conditions favoring these rather rare events are poorly understood. Variants with the efficient human-to-human transmissibility trait must randomly evolve during zoonotic infection and then replicate to titers allowing transmission to a new individual. We propose that the latter step occurs rarely because the immune response triggered by zoonotic influenza virus also controls transmissible mutants that emerge during infection. Methods Here we use mathematical models of within-host infection dynamics to evaluate the conditions for emergence of a transmissible mutant during zoonotic influenza virus infection (emergence being defined as the mutant’s ability to replicate and increase titers). We used deterministic systems of coupled differential equations to follow in time the number of cells infected with the zoonotic and transmissible virus variants, as the latter evolves at different time points after the start of the zoonotic infection. The dynamics of innate and adaptive immune responses were modeled and varying their strengths accounted for immunocompetent and immunocompromised conditions. Results We found that within-host emergence of a transmissible variant could occur in an immunocompetent individual, provided it evolved early during infection, specifically before the replication peak of the zoonotic virus. The later the transmissible variant evolved, the less it replicated; variants evolving after the replication peak of the zoonotic virus did not emerge due to immune-mediated exclusion (Fig.). In contrast, in an immunocompromised individual, transmissible variants could emerge irrespective of the time of their evolution during zoonotic infection. Furthermore, because of different receptor binding affinity, the transmissible variant had a fitness advantage and predominated in the upper respiratory tract (Fig.). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L24 L E C TU R E A BSTRAC TS Figure: Replication of zoonotic (wild-type) and transmissible (mutant) viruses after mutant evolution (from Reperant et al. The Lancet, 2014). Figure: Replication of zoonotic (wild-type) and transmissible (mutant) viruses after mutant evolution (from Reperant et al. The Lancet, 2014). • Conclusions: Conclusions The evolution of a novel pandemic influenza virus may rarely occur in humans, when deficient immune fail to controlinfluenza the replicationvirus of a transmissible The evolution of a responses novel pandemic may rarely occur in humans, when deficient immune responses variant during zoonotic infection. Immunocompromised individuals thus may represent the elusive index cases for the generation of a transmissible variant of fail to control the replication of a transmissible variant during zoonotic infection. Immunocompromised individuals zoonotic influenza virus, to titers capable of initiating chains of human-to-human thus may represent the elusive index cases for the generation of a transmissible variant of zoonotic influenza virus, infection. to titers capable of initiating chains of human-to-human infection. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L25 L E C TU R E A BSTRAC TS SPB302 ALFA Seroprotection threshold and persistence of seroprotective titer among 2007H1N1 infected subjects: results from the Flurec cohort study Markovic Delabre, Rosemary (1,2); Salez, Nicolas (3); Lemaitre, Magali (4); Leruez-Ville, Marianne (5,6); de Lamballerie, Xavier (3,7,8); Carrat, Fabrice (1,2,9) 1: Institut National de la Santé et de la Recherche Médicale, UMR-S 707, Paris, France; 2: Université Pierre et Marie Curie-Paris 6, UMR-S 707, Paris, France; 3: Unité des Virus Emergents, UMR-D 190, Aix-Marseille université and Institut de Recherche pour le Développement, Marseille, France; 4: National Agency for the Safety of Medicine and Health Products, St Denis; 5: Université Paris Descartes, Sorbonne Paris Cité, EA 3620, Paris, France; 6: Laboratoire de Virologie, Hôpital Necker, AP-HP, Paris, France; 7: Laboratoire de Virologie, Pôle hospitalier de Microbiologie et Maladies Infectieuses, Assistance Publique, Hôpitaux de Marseille, France; 8: Ecole des Hautes Etudes en Sante Publique, Rennes, France; 9: Assistance Publique-Hôpitaux de Paris,Hôpital Saint Antoine, Unité de Santé Publique, F-75012 Paris, France Background Haemagglutination-inhibiting (HI) titers, following natural infection and/or vaccination, and their persistence through time, are important to determining individual susceptibility to infection. However, few studies have reported long-term data regarding the magnitude and duration of HI titers following infection. Using data from a French cohort study, designed to identify risk factors of recurrent influenza infection, we studied antibody dynamics among subjects with and without confirmed seasonal 2007H1N1 infection over time. Methods This study focuses on the 2007-2008 H1N1 influenza epidemic and concerns cohort subjects recruited in 2008. Subjects were recruited during general practitioner visits and stratified by age (10-year age groups) and medical visit reason (influenza-like illness (ILI) or an illness unrelated to ILI). Serological samples and information regarding vaccinal status were collected at all three annual study visits. Infection was defined as laboratory-confirmed influenza A/2007H1N1 on a nasal swab by RT-PCR collected for all ILI subjects at inclusion. This analysis depended on a total of 621 samples for 224 unvaccinated subjects. Subjects were analyzed according to ILI and infection status at inclusion (Infected ILI, Non-Infected ILI, and Non-ILI). 2007H1N1 titers ≥ 40, according to conventional standards, were considered protective. General additive mixed models were fit to log-transformed HI data to study the evolution of HI titer during study follow-up. Seroprotection threshold titer, defined as the titer associated with 50% protection against infection, was determined using generalized linear model with a logistic regression fit. Results Among the 103 ILI subjects, 2007H1N1 infection was identified in 34. A total of 55 (infected ILI subjects n=22; uninfected ILI subjects n=33) had titers ≥40 by the 2008 annual study visit. Infected ILI subjects reached peak GMT (73.1, 95CI: 55.4, 96.5) up to 8 months following infection (Figure 1); up to 22 months following infection, 50% of subjects had titers ≥40. However, titers rise again late during the 2009-2010 influenza season. Titers among uninfected ILI subjects remained stable throughout study duration. A 2007H1N1 titer of 20.2 (95CI: 7.1; 28.7) was associated with 50% protection against 2007H1N1 infection. Conclusions Subjects reaching HI titer ≥40 after infection were able to maintain this titer level for almost 2 years post-infection. Rise in 2007H1N1 titers during the 2009-2010 influenza season suggest a cross-reactive antibody response with H1N1pdm09. We found that the conventional protective titer (HI titer ≥ 40) was conservative compared to our seroprotection threshold estimate. These results have important implications in the understanding of longterm immunogenicity. Figure 1: 2007H1N1 antibody dynamics among subjects with 2007H1N1 titer ≥40 at first annual visit (2008): Infected ILI subjects vs Non-Infected ILI subjects TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L26 to our seroprotection threshold estimate. These results have important implications in the understanding of long-term immunogenicity. L E C TU R E A BSTRAC TS Word count: 399 + 50 (figure) Figure 1: 2007H1N1 antibody dynamics among subjects with 2007H1N1 titer ≥40 at first annual visit (2008): Infected ILI subjects vs Non-Infected ILI subjects TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L27 L E C TU R E A BSTRAC TS SPB303 ALFA Inferring Influenza Infection Attack Rate from Seroprevalence Data Wu, Joseph (1); Leung, Kathy (1); Perera, Ranawaka APM (1); Chu, Daniel KW (1); Lee, Cheuk Kwong (2); Hung, Ivan FN (3); Lin, Che Kit (2); Lo, Su-Vui (4); Lau, Yu-Lung (5); Leung, Gabriel M (1); Cowling, Benjamin J (1); Peiris, JS Malik (1) 1: School of Public Health, The University of Hong Kong, Hong Kong S.A.R. (China); 2: Hong Kong Red Cross Transfusion Services, Hong Kong S.A.R. (China); 3: Department of Medicine, The University of Hong Kong, Hong Kong S.A.R. (China); 4: Hospital Authority, Hong Kong S.A.R. (China); 5: Department of Paediatrics and Adolescent Medicine, The University of Hong Kong, Hong Kong S.A.R. (China) Background Seroprevalence studies are crucial for estimating infection attack rate and disease severity in an epidemic such as influenza. These studies typically entail selecting a titer threshold for seropositivity (e.g. microneutralization [MN] 1:40) and assuming the probability of seropositivity per infection (infection-seropositivity probability, ISP) among community infections is 100% or similar to that among clinical cases. Different thresholds applied to the same seroprevalence data may give different IAR estimates if serologic responses of clinical cases is not representative (e.g. clinical cases have higher ISP). Methods and Results To illustrate this conjecture, we fitted a transmission model to the 2009 pandemic influenza A/H1N1 (pdmH1N1) hospitalization and seroprevalence data in Hong Kong. We estimated that while almost all pdmH1N1 infections became MN1:20 seropositive, only 72%, 62%, 58% and 34% of infections among age 3-12, 13-19, 20-29, 30-59 became MN1:40 seropositive, much lower than the 90%-100% observed among clinical cases. The fitted model was consistent with prevailing consensus on pdmH1N1 transmission characteristics (e.g. initial reproductive number of 1.28 and mean generation time of 2.4 days), hence our ISP estimates were consistent with the transmission dynamics and temporal buildup of population-level immunity. Conclusions Incidence of pdmH1N1 in Hong Kong and other countries might have been previously underestimated, especially among adults, due to overestimations of ISP. Because antibody kinetics among asymptomatic or mild community infections will likely to be lacking during a pandemic, real-time seroprevalence studies should evaluate the consistency of IAR estimates across multiple thresholds to provide timely and robust estimates of disease burden and severity. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L28 L E C TU R E A BSTRAC TS SPB304 ALFA The MISMS program: highlights of an international influenza research network Miller, Mark Andrew; Collaborating Team, MISMS FIC/NIH/DHHS, United States of America Introduction The Multinational Influenza Seasonal Mortality Study (MISMS) network was initiated in 2001 by the Fogarty International Center, to research the epidemiology and evolutionary dynamics of influenza and build analytical capacity. We highlight the main findings of the MISMS program from the past year with a focus on influenza transmission dynamics. Methods Multinational and bilateral collaborations through MISMS researchers facilitate the collection and analysis of international influenza related data and disseminate findings through scientific publications, conference presentations, and interactive workshops for investigators and decision‐makers. To date, influenza epidemiological and genetic sequence data have been shared between more than 30 countries, representing ~3.2 billion people, resulting in over 220 peer‐reviewed publications and more than 9400 citations. Findings The MISMS network has a focus on assessing the transmission dynamics and dissemination of emerging influenza threats, particularly as it related to trade and connectivity. Leveraging increased influenza sampling from Africa in the context of the 2009 A/H1N1 pandemic, MISMS researchers demonstrated the multiyear persistence of two pandemic virus lineages in West Africa, likely due to asynchronous timing of influenza activity and low global connectivity of this region. These findings highlight the potential for new virus variants to evolve within Africa and the need for intensified surveillance in this and other undersampled regions. In the United States, MISMS researchers have shown that the fall wave of the 2009 pandemic travelled over a 3‐month period in a highly diffusive pattern across the US, unlike seasonal epidemics which spread over a few weeks through large population centers. High attack rates among children, who may not travel as much as adults, combined with the relatively low transmissibility, may explain the slow diffusion of the pandemic virus in the US. From an historical perspective, review of data from the 1918 pandemic has revealed great variation in the overall burden, timing, and age patterns of excess mortality between countries, potentially due to regional differences in connectivity in the 19th and early 20th century correlated prior immunity from differential past viral exposures. Finally, phylogeographic analyses have highlighted the importance of swine trade in the dissemination of swine viruses both within the US and globally, echoing the diffusion of influenza in humans. In contrast to human viruses however, diffusion of a new swine influenza variants may take from months to years. Conclusions MISMS research findings demonstrate the value of contrasting the ecology and evolutionary dynamics of influenza across hosts and countries, and the benefits of grounding and calibrating models against empirical data. Further work is needed to fully understand the global migration of pandemic and seasonal influenza viruses in human, swine and other hosts, and how this relates to host movements, demographic factors, and prior immunity. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L29 L E C TU R E A BSTRAC TS 1 6 SEPTEM B ER 20 14 SPA4: ANTIVIRALS AND RESISTANCE SPA401 OMEGA Influenza A(H7N9) virus gains neuraminidase inhibitor resistance without loss of in vivo virulence or transmissibility Hai, Rong (1); Schmolke, Mirco (1,2); Leyva-Grado, Victor H. (1); Thangavel, Rajagowthamee R. (1); Margine, Irina (1); Jaffe, Eric L. (1); Krammer, Florian (1); Solórzano, Alicia (4); García-Sastre, Adolfo (1,2,3); Palese, Peter (1,3); Bouvier, Nicole M. (1,3) 1: Department of Microbiology, Icahn School of Medicine at Mount Sinai, One Gustave L Levy Place, Box 1124, New York, New York 10029, USA; 2: Global Health and Emerging Pathogens Institute, Icahn School of Medicine at Mount Sinai, One Gustave L Levy Place, Box 1124, New York, New York 10029, USA; 3: Division of Infectious Diseases, Department of Medicine, Icahn School of Medicine at Mount Sinai, One Gustave L Levy Place, Box 1124, New York, New York 10029, USA; 4: Public Health Research Institute and Regional Biocontainment Laboratory, New Jersey Medical School, RUTGERS, The State University of New Jersey, 225 Warren Street, Newark, New Jersey 07103, USA Background Since there is no baseline human immunity to the novel avian origin influenza A (H7N9) virus emerged in eastern China in the spring of 2013, the neuraminidase (NA) inhibitors oseltamivir and zanamivir are vital for controlling viral replication in severe infections. An amino acid change associated with drug resistance, NA-R292K (N2 numbering), has been found in patients infected with H7N9 influenza A viruses and treated with NA inhibitors. However, resistance mutations usually result in a loss in viral fitness, which may be restored by additional compensatory changes in the viral genome. Methods Here, we investigate whether the R292K-encoding NA of a recent H7N9 clinical isolate confers NA inhibitor resistance and whether it affects the replication or pathogenicity of this strain in primary human tracheobronchial epithelial (hTBE) cell culture and in a mouse virulence model. We also explore the replicative ability of oseltamivir-sensitive and -resistant H7N9 viruses in the lungs of mice treated with oseltamivir or zanamivir, as well as the respiratory droplet transmissibility of these viruses in the guinea pig model. Results Our results demonstrate that the acquisition of high-level oseltamivir resistance, via the NA-R292K mutation, can significantly impair the sialidase activity of the H7N9 NA without compromising viral replication, virulence, or transmissibility in these experimental models. Conclusions Compared to seasonal A(H3N2) viruses bearing the R292K resistance mutation, H7N9 IAV replication and pathogenicity in these models are not substantially altered by the acquisition of high-level oseltamivir resistance. These findings underscore the multigenic and sometimes unpredictable nature of the fitness of influenza A viruses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L30 L E C TU R E A BSTRAC TS SPA402 OMEGA Influenza antiviral susceptibility monitoring in Europe – taking stock of 10 years’ experience, 2004-2014 Meijer, Adam (1,10); Lackenby, Angie (2,10); Pereyaslov, Dmitriy (3); Enouf, Vincent (4,10); Kossyvakis, Athanasios (5,10); Lina, Bruno (6,10); Rebelo-de-Andrade, Helena (7,10); Pozo Sánchez, Francisco (8,10); Hay, Alan (9); McCauley, John (9); Daniels, Rod (9); Zambon, Maria (2) 1: National Institute for Public Health and the Environment, Bilthoven, The Netherlands; 2: Public Health England Colindale, London, United Kingdom; 3: Division of Communicable Diseases, Health Security, & Environment, World Health Organization Regional Office for Europe, Copenhagen, Denmark; 4: Centre National de Référence du Virus Influenza Région North, Institut Pasteur, Paris, France; 5: National Influenza Reference Laboratory of Southern Greece, Institut Pasteur Hellénique, Athens, Greece; 6: Centre National de Référence du Virus Influenza Région Sud, Laboratoire de Virologie Est, Institut de Microbiologie Bat A3, Centre de biologie et de pathologie Est, HCL, Lyon, France; 7: Instituto Nacional de Saúde, and Faculdade de Farmácia, Universidade de Lisboa, Lisbon, Portugal; 8: National Influenza Centre, Influenza and Respiratory Viruses Unit, Centro Nacional de Microbiología, Instituto de Salud Carlos III, Majadahonda, Madrid, Spain; 9: World Health Organization Collaborating Centre for Reference and Research on Influenza, MRC-National Institute for Medical Research, The Ridgeway, Mill Hill, London, United Kingdom; 10: ECDC antiviral susceptibility task group (AVTG) members Background Influenza antiviral drug susceptibility monitoring has become an important activity of WHO National Influenza Centres (NICs) and ERLI-Net in Europe. With the availability, stockpiling, and wider use of neuraminidase inhibitors Background (NAI) and the emergence of natural NAI resistant variants, identification of variant viruses with reduced inhibition Influenza antiviral drug susceptibility monitoring has become an important activity of WHO by NAI andCentres M2 (NICs) ion-channel blockers is With necessary to inform the clinical management of influenza patients and National Influenza and ERLI-Net in Europe. the availability, stockpiling, and wider use of neuraminidase inhibitors (NAI) and the emergence of natural NAI resistant outbreak management. variants, identification of variant viruses with reduced inhibition by NAI and M2 ion-channel blockers is necessary to inform the clinical management of influenza patients and outbreak management. Methods Antiviral susceptibility (AS) testing coordinated with surveillance and reporting via a web-based system was initiated Methods through VIRGIL and EISS EU funded projects in 2004 (Figure 1). A database with online data analysis facilities was Antiviral susceptibility (AS) testing coordinated with surveillance and reporting via a web-based developed, to collate AS EISS dataEUgenerated nationally and1).centrally within Europe, together with epidemiological system was initiated 1) through VIRGIL and funded projects in 2004 (Figure A database online data, data analysis was developed, 1) toincollate AS data generated andwith clinical and facilities 2) to assist countries the analysis and interpretation of AS data. Data collection and further nationally and centrally within Europe, together with epidemiological and clinical data, and 2) to of ASandtesting capabilities have continued through the ERLI-Net and EuroFlu networks. The AVTG assistdevelopment countries in the analysis interpretation of AS data. Data collection and further development of AS testing capabilities development have continued through ERLI-Net protocols, and EuroFlu guidance and tools for testing and interpretation of contributed to database andthe provided networks. The AVTG contributed to database development and provided protocols, guidance and AS data. tools for testing and interpretation of AS data. Results The usefulness of centralized data collection and analysis, with efforts to increase the capability for national AS TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L31 L E C TU R E A BSTRAC TS monitoring, were fully validated by the response to the events of the 2007/2008 winter season when emergence of high levels of natural neuraminidase (NA)-H275Y oseltamivir resistant A(H1N1) viruses was first demonstrated in Europe. The database was the key tool used at European and global level for accurate dissemination of A(H1N1) NA-H275Y prevalence and geographical spread data. Also the emergence of natural adamantane resistant A(H1N1) and A(H3N2) viruses with M2-S31N was closely monitored, which gained increased importance, as the options for antiviral treatment and prophylaxis became limited due to the simultaneous emergence of A(H1N1) NA-H275Y. Again, during the 2009 A(H1N1)pdm09 pandemic its usefulness was emphasized by allowing the identification and tracking of (highly) reduced inhibition by neuraminidase inhibitors, mainly due to NA-H275Y, among A(H1N1) pdm09 influenza viruses in Europe. Furthermore, collection of clinical data allowed the pooled analysis of the potential effect of A(H1N1) NA-H275Y on the severity of infection; which appeared to be absent. Conclusions Joined efforts increased the capacity for AS monitoring in the WHO European Region, reflected in effective responses to emergencies and continuous vigilance by weekly analysis and reporting of AS surveillance data. Ongoing challenges are to introduce AS monitoring in a wider number of NICs and further standardization of analyses performed on pooled phenotypic and genotypic AS monitoring data. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L32 L E C TU R E A BSTRAC TS SPA403 OMEGA Evidence for clinical efficiency potential of anti-H5N1 polyclonal immunoglobulins Fabenflu® Herbreteau, Cécile Hélène (1); Buchy, Philippe (2); Bal, Céline (1); Durand, Caroline (1); Tambyah, Paul (3); Lépine, Bertrand (1) 1: Fab’entech, France; 2: Institut Pasteur, Cambodia; 3: National University Hospital, Singapore Background Regarding the insufficiency of therapeutic solutions for the management of H5N1 infected patient, specific antiH5N1 polyclonal immunoglobulins were developed. A strong neutralizing (and cross-neutralizing) activity was previously demonstrated by the pre- clinical characterization of anti-H5N1 immunoglobulin F(ab’)2 fragments (Fabenflu®) (Herbreteau et al., 2014). Following these studies, a product for human use was produced and a phase I clinical trial was designed and conducted in Singapore to assess the safety of the proposed therapeutic protocol, and determine the pharmacokinetic profile of intravenous injections. The excellent safety profile of the product was confirmed by this study. In addition to the phase I clinical trial, complementary studies were performed to (1) document the efficacy of Fabenflu® in human plasma or serum at concentrations equivalent to the ones measured during the phase I clinical trial and (2) evaluate the residual neutralizing activity of the human plasmas collected in healthy human volunteers during the phase I clinical trial. Methods Human plasmas and sera spiked with Fabenflu®, or human plasmas collected in healthy human volunteers during the phase I clinical trial, were tested by classical in vitro serum neutralization and hemagglutination inhibition assays on H5N1 A/Vietnam/1194/04 strain. Results A neutralizing activity was evidenced in human serum and plasma spiked with Fabenflu® even at low concentrations, from 5 μg/mL. Neutralization titer rates up to 1:12 were found in the plasma of human healthy volunteers sampled during the phase I clinical trial. The serum neutralization activity increase with the augmentation of plasmatic concentration of Fabenflu® measured by ELISA. Conclusions The neutralizing efficacy of Fabenflu® was confirmed in a human matrix, and at therapeutic concentration. Fabenflu® neutralizing activity on the H5N1 avian influenza virus was confirmed by both the spiking experiment and the analysis of the human plasmas collected during the phase I clinical trial. These data, associated with safety and pharmacokinetic data from the phase I clinical trial and cross-reactivity data on 21 H5N1 strains, demonstrate the excellent potential of Fabenflu® as a new therapeutic approach in the clinical management of H5N1 infected patient. Special accesses are explored in order to answer to public health need and ensure the availability of this agent in exposed countries, pending the granting of a marketing authorization. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L33 L E C TU R E A BSTRAC TS SPA404 OMEGA A community cluster of influenza A(H1N1)pdm09 virus exhibiting crossresistance to oseltamivir and peramivir in Japan, November 2013 to February 2014 Takashita, Emi (1); Ejima, Miho (1); Fujisaki, Seiichiro (1); Yokoyama, Masaru (2); Nakamura, Kazuya (1); Shirakura, Masayuki (1); Sugawara, Hiromi (1); Sato, Aya (1); Sato, Hironori (2); Tashiro, Masato (1); Odagiri, Takato (1) 1: National Institute of Infectious Diseases, Influenza Virus Research Center, Japan; 2: National Institute of Infectious Diseases, Pathogen Genomics Center, Japan Background In Japan, four neuraminidase (NA) inhibitors, oseltamivir, peramivir, zanamivir and laninamivir, are approved for chemotherapy against influenza and are prescribed with the highest frequency in the world. Therefore, Japan could be at high risk of the emergence and spread of NA inhibitor-resistant viruses. We have conducted nationwide monitoring for NA inhibitor-resistant viruses in cooperation with 74 local public health institutes. The nationwide monitoring is important for public health planning and clinical recommendations for antiviral use. Methods Clinical specimens were collected in 500 sentinel hospitals consisting of pediatrics and internal medicine as part of the National Epidemiological Surveillance of Infectious Diseases in Japan. Most specimens were collected at the first visit to clinics before drug use. Influenza viruses were isolated from the specimens in 74 local public health institutes. Between September 2013 and May 2014, 2,221 A(H1N1)pdm09 viruses were detected and then screened by allelic discrimination assay and/or NA gene sequencing to detect an H275Y substitution, which confers resistance to oseltamivir and peramivir. The susceptibility of the viruses to four NA inhibitors approved in Japan was determined by fluorescent enzyme inhibition assay. Results were expressed as the drug concentrations required to inhibit NA activity by 50% (IC50). Results We found that 97 (4.4%) of the 2,221 A(H1N1)pdm09 viruses possessed the H275Y substitution. Thirty-four of the 97 H275Y mutant viruses were detected in Sapporo, the capital city of Hokkaido, the second-largest island in Japan, between November 2013 and February 2014. In Sapporo, 108 A(H1N1)pdm09 viruses were detected between September 2013 and May 2014, and 34 (31.5%) of the 108 viruses possessed the H275Y substitution. Elsewhere in Hokkaido, 5 (19.2%) of the 26 A(H1N1)pdm09 viruses possessed the H275Y substitution. Outside Hokkaido, 58 (2.8%) of the 2,087 A(H1N1)pdm09 viruses were the H275Y mutants. All H275Y mutant viruses exhibited highly reduced inhibition by oseltamivir and peramivir, but remained fully susceptible to zanamivir and laninamivir. No epidemiological link among the H275Y cases in Hokkaido could be identified and none of them had received NA inhibitors before specimen collection. The haemagglutinin and NA genes of the H275Y mutants in Hokkaido were closely related to one another, suggesting clonal spread of a single mutant virus. The H275Y mutant viruses in Hokkaido possessed three additional substitutions in NA and single substitution in PB1, nucleoprotein, haemagglutinin and matrix protein (M1), respectively. Studies are underway to elucidate the effect of these substitutions on the stability and transmissibility of the mutant virus. Conclusions A community cluster of A(H1N1)pdm09 virus exhibiting cross-resistance to oseltamivir and peramivir occurred in Sapporo, Japan, between November 2013 and February 2014. The nationwide monitoring should be continued, particularly for the choice of antivirals. This study was conducted by collaboration with the influenza virus surveillance group of Japan. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L34 L E C TU R E A BSTRAC TS SPB4: ANIMAL FLU-ECOLOGY AND EPIDEMIOLOGY OF ANIMAL INFLUENZA SPB401 ALFA Equine Influenza virus surveillance in Ireland – findings of international significance Gildea, Sarah; Cullinane, Ann Irish Equine Centre, Ireland Background Equine influenza (EI) is considered the most important respiratory pathogen of the horse and outbreaks in endemic populations continue to cause economic loss despite widespread mandatory vaccination. Ireland is the 4th largest producer of Thoroughbred horses in the world and the majority of these are exported worldwide. The gross value of the equine industry to our economy is in excess of €1 billion euros per annum. The aim of this study was to carry out a comprehensive analysis of EI outbreaks in Ireland, to identify key management and environmental factors that determine the risk of horses contracting EI, to genetically characterise EI viruses responsible for outbreaks and to highlight any evidence of vaccine breakdown. Methods Between 2007 and 2014 epidemiological investigations involving 587 horses on 28 premises where EI outbreaks occurred were undertaken. Results Outbreaks occurred among Thoroughbred horses, non-Thoroughbred horses, ponies and donkeys. With one exception, all outbreaks were associated with movement of horses but no epidemiological link between affected premises was established. Veterinary advice was sought on average six days after first clinical signs were observed. The majority of diagnosis was made by RT-PCR. Of the 587 horses, 47% were clinically affected, 41% were identified as confirmed cases and 10% were subclinically affected. Vaccination status, age, housing type, teaser stallions and fomites were all identified as risk factors involved in virus spread. Analysis of the HA1 sequence data generated for 44 viruses identified indicated that with the exception of those which circulated from November 2009 to January 2010 all viruses belong to clade 2 of the Florida sublineage of the American lineage. Viruses identified from November 2009 to January 2010 belonged to clade 1 of the Florida sublineage. This was the first time clade 1 viruses were identified in Ireland. Following several outbreaks of EI in the UK and the first outbreak of EI in Australia where the index cases were horses which had travelled from Ireland, sequence data generated during this study highlighted that the index cases during an outbreak may not necessarily be the original source of the virus. Viruses identified during this study were submitted annually for review by the OIE Expert Surveillance Panel which makes recommendations for updating vaccine strains. None of the EI vaccines available in Ireland have been updated in line with OIE recommendations of 2010 to include both clade 1 and clade 2 viruses. Vaccine failure was observed in this study among horses vaccinated with all four commercially available vaccines. Conclusions The identification of key management and environmental factors which assist in EI virus spread along with appropriate preventative and controls measures should reduce the economic losses associated with EI. The findings of this study endorse the OIE recommendations. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L35 L E C TU R E A BSTRAC TS SPB402 ALFA European surveillance network for influenza in pigs (ESNIP): Surveillance programs, diagnostic tools and swine influenza viruses identified in 14 European countries from 2010 to 2013 Simon, Gaëlle (1); Larsen, Lars E (2); Dürwald, Ralf (3); Foni, Emanuela (4); Van Reeth, Kristien (5); Reid, Scott M (6); Harder, Timm (7); Dan, Adam (8); Markowska-Daniel, Iwona (9); Maldonado Garcia, Jaime (10); Huovilainen, Anita (11); Billinis, Charalambos (12); Davidson, Irit (13); Agüero Garcia, Montserrat (14); Bublot, Michel (15); Brown, Ian H (6); Loeffen, Willie (16) 1: Anses, Ploufragan, France; 2: DTU, Copenhagen, Denmark; 3: IDT-Biologika GmbH, Dessau-Rosslau, Germany; 4: IZSLER, Parma, Italy; 5: Ghent University, Ghent, Belgium; 6: AHVLA, Weybridge, United Kingdom; 7: FLI, Reims, Germany; 8: Nébih, Budapest, Hungary; 9: NVRI, Pulawy, Poland; 10: HIPRA, Gerona, Spain; 11: EVIRA, Helsinki, Finland; 12: Thessaly University, Karditsa, Greece; 13: KVI, Rishon L’Tzion, Israel; 14: LCV, Algete, Spain; 15: Merial, Lyon, France; 16: CVI, Lelystad, The Netherlands Swine influenza causes concern for global veterinary and public health. Thus, ongoing knowledge of viral strains and lineages circulating in pigs is indispensable not only for the prevention and control of the disease in pigs, but also to detect reassortant viruses that may pose a threat to the human population, as was the case for the novel H1N1 virus responsible for the last pandemic in 2009 (H1N1pdm). In continuation to two previous coordination actions that initiated the surveillance for swine influenza viruses (SIVs) circulating in European pigs between 2001 and 2008, a third phase of the European Surveillance Network for Influenza in Pigs (ESNIP3), aimed to expand widely the knowledge of the epidemiology of European SIVs from 2010 to 2013. ESNIP3 stimulated programs of harmonized SIV surveillance in European countries and supported the coordination of appropriate diagnostic tools and subtyping methods. Thus, in an extensive virological monitoring, mainly conducted through passive surveillance programs, more than 9 000 herds in 17 countries were examined over a period of three years. Influenza A viruses were detected in 31% of these herds, from which 1887 viruses were subtyped preliminary. The dominating lineages were identified to represent the three previously known European enzootic SIVs, i.e. the avianlike swine H1N1 (53.6%), the human-like reassortant swine H1N2 (13%) and the human-like reassortant swine H3N2 (9.1%), but also viruses from the H1N1pdm lineage (10.3%). Viruses from these four lineages co-circulated in several countries, but with very different relative levels of incidence. The H3N2 subtype, for instance, was missing from some geographic areas whereas it was still prevalent in other parts of Europe. Interestingly, areas free of H3N2 were those that exhibited the highest frequencies of H1N2 viruses in circulation. H1N1pdm viruses were detected at an increasing rate in some countries throughout the three year period, indicating that this subtype has become established in the European pig population. Finally, 13.9% of the viruses represented reassortants between these four lineages. Among them, reassortants between older enzootic SIVs and H1N1pdm emerged at the same time in several countries. They were detected at an increasing frequency in 2012-2013, indicating that some of them might become established in pig herds and potentially provide implications for zoonotic infections. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L36 L E C TU R E A BSTRAC TS SPB403 ALFA Pathobiology of novel genotype of H9N2 containing polymerase (PB2, PB1, PA) and non-structural (NS) gene segments derived from high pathogenicity H7N3 avian influenza virus Iqbal, Munir (1); Yaqub, Tahir (2); Mukhtar, Nadia (2); Shabbir, Muhammad Z (2); McCauley, John W (3) 1: Avian Viral Diseases Programme,The Pirbright Institute, United Kingdom; 2: University of Veterinary and Animal Sciences, Lahore, Pakistan; 3: Division of Virology, MRC National Institute for Medical Research, Mill Hill, London Background Genetic changes in avian influenza viruses influence their infectivity, virulence and transmission. Recently we identified a novel genotype of H9N2 viruses in widespread circulation in domestic poultry on the Indian subcontinent and in the Middle East containing the polymerase (PB2, PB1 and PA) and non-structural (NS) gene segments which were identical to highly pathogenic H7N3 viruses. The other genes shared homology to the G1-like H9N2 virus lineage. Infections with H9N2 have been reported in a diverse variety of wild avian species including quail, crows and sparrows. Limited data are available that describe the relative infectivity and transmissibility of these novel H9N2 viruses in different poultry breeds and terrestrial wild bird species. Here, we investigated the potential of this novel genotype of H9N2 virus to cause disease in poultry and wild terrestrial avian species and assess the transmission capability between these species. Materials and methods Groups of chicken broilers, chicken layers, jungle fowl, quail, sparrows or crows were inoculated with a representative strain (A/chicken/UDL-01/08) of this novel H9N2 virus and then co-housed with naïve birds of the same breed or species. Transmission between different species was examined by co-housing infected broilers with naïve sparrows and vice versa. Pathogenesis in birds was monitored by recording clinical disease signs. Buccal and cloacal swab samples were taken and analysed for virus shedding and blood samples allowed the detection of H9N2 virus-specific antibodies using haemagglutination inhibition tests. Results With the exception of crows, all directly inoculated and contact birds showed clinical signs, varying in severity with quail showing the most pronounced clinical signs. Viral shedding was detected in all infected birds, with quail showing the greatest levels of virus secretion; however, only very low levels of virus were found in directly infected crow samples. Efficient virus intra-species transmission was observed within each group with the exception of crows in which no evidence of transmission was seen. Interspecies transmission was examined between chickens and sparrow and vice versa and efficient transmission was seen in both directions. Conclusions Our results indicated that reassortant H9N2 viruses currently circulating on the Indian sub- continent and in the Middle East can cause clinical disease in experimentally infected commercial and backyard chicken breeds as well as in quail and house sparrows. Our observations of efficient transmission between different chicken breeds, from quail to quail, and from chickens to sparrows or vice versa is a worrying scenario in which the quail and sparrows could be potential intermediate hosts for maintenance of viruses and the transmission of these viruses to poultry. Crows seem less of a problem because although they became infected they did not transmit the virus to contacts and had only low virus titres in swabs. These data, along with the recent identification in China of a human zoonotic H7N9 virus that contains the polymerase genes from a H9N2 virus, warrant an increased surveillance of circulating H9N2 viruses. Further experimental infection studies of new reassortant H9N2 viruses will be needed to assess their pathogenicity and transmissibility in different poultry hosts and terrestrial wild bird species, especially those that might act as carriers and as a reservoir of infection and potentially shuttle the viruses between poultry and, possibly, hence to humans. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L37 L E C TU R E A BSTRAC TS SPB404 ALFA Isolation of H15N7 influenza virus from wild birds in Eastern Europe and its relationship to viruses from other regions Muzyka, Denys (1); Pantin-Jackwood, Mary (2); Fereidouni, Sasan (3) 1: National Scientific Center Institute of Experimental and Clinical Veterinary Medicine, Ukraine; 2: Southeast Poultry Research Laboratory, Agricultural Research Service, USDA, Athens, Georgia; 3: WESCA Wildlife Network; Friedrich Loeffler Institute, Riems, Germany Background Continuous monitoring of influenza viruses circulating in the natural reservoir in wild birds is important for early warning and forecasting of epizootic and epidemiological situation with influenza. These studies allow getting much valuable information on the environmental features of influenza viruses’ circulation, new ecological niches of viruses, to detect new variants of the virus and establish their introduction into new geographic regions. Methods Monitoring of AIVs in wild birds of 27 families and 11 genera was conducted in 2006-2012 in the Azov-Black Sea region of Ukraine. Results As part of the monitoring of wild bird influenza in 2010 an influenza virus subtype H15N7 was isolated (А/mallard/ Novomychalivka/2-23-12/10) from a clinically healthy wild mallard (Anas platyrhynchos) in the Azov-Black Sea region of Ukraine. This virus grew well in chicken embryos without causing their death. The HA titer was 1:512, and the infectious titer was 6,5 lg EID50/0.2 ml. This subtype of virus circulated only in wild birds of Australia, but in 2008 the virus A/teal/Chany/7119/2008 (H15N4) was isolated from wild birds in Western Siberia (Russia). Phylogenetic analysis of HA15 gene Ukrainian virus (А/mallard/Novomychalivka/2-23- 12/10 H15N7) showed that the virus was closely related to the virus A/teal/Chany/7119/2008 (H15N4) from Russia, and the N7 gene it was related to avian influenza viruses of H7N7 and H10N7 subtypes circulating in wild birds in Western Europe. M gene sequencing revealed a close relationship with AIV of different subtypes from Russia and Mongolia, and analysis of the NP, NS, and PB1 genes revealed that the Ukrainian virus is related to influenza viruses of different subtypes from Norway and Sweden, and the PB2 gene sequence was similar to viruses of Asian origin. Conclusions The H15N7 avian influenza subtype was isolated for the first time from wild birds in Eastern Europe. This virus is a reasortant between influenza viruses of different subtypes from Western Europe, Western Siberia and Asia. These results support the need for regular monitoring of influenza viruses circulating in the Azov-Black Sea region in order to study the characteristics of their circulation and the possible introduction of new genetic variants of the virus. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L38 L E C TU R E A BSTRAC TS SPA5: VACCINES: CURRENT AND NOVEL APPROACHES SPA501 OMEGA Modified vaccinia Ankara encoding influenza hemagglutinin induces heterosubtypic immunity in macaques Florek, Nicholas W. (1,2); Weinfurter, Jason T. (1,2); Jegaskanda, Sinthujan (3); Brewoo, Joseph N. (4); Powell, Tim D. (4); Young, Ginger R. (4); Das, Subash C. (4); Hatta, Masato (1); Broman, Karl W. (1); Hungnes, Olav (5); Dudman, Susanne G. (5); Kawaoka, Yoshihiro (1); Kent, Stephen J. (3); Stinchcomb, Dan T. (4); Osorio, Jorge E. (1,4); Friedrich, Thomas C. (1,2) 1: University of Wisconsin, USA; 2: Wisconsin National Primate Research Center, USA; 3: University of Melbourne, Australia; 4: Takeda Vaccines, USA; 5: Norwegian Institute of Public Health, Norway Background Current influenza vaccines primarily aim to induce neutralizing antibodies (NAbs). These vaccines are highly effective against well-matched strains, but do not offer broad protection against emerging strains. A vaccine that elicits both T cell and B cell responses might induce more broadly protective immunity. Modified vaccinia Ankara (MVA) is a safe and well-characterized vector for inducing both antibody and cellular immunity; in this study, we evaluated the immunogenicity and protective efficacy of MVA vaccines expressing hemagglutinin (HA) and/or nucleoprotein (NP) in a translational macaque model. Methods We tested 4 MVA constructs encoding either HA from an H1N1 virus; the H1 HA with NP from an H5N1 virus; HA and NP from an H5N1 virus; or H5N1 NP alone. Vaccines were given to cynomolgus macaques (Macaca fascicularis) intradermally in 2 doses of 108 pfu 4 weeks apart. 8 weeks later, animals were challenged with 107 pfu of the pandemic isolate A/California/04/2009 (H1N1pdm). During the vaccination and challenge phases, we monitored neutralizing and HA- binding antibody responses; virus-specific CD4+ and CD8+ T cells; and antibody-dependent natural killer (NK) cell activation. Results MVA-based vaccines encoding HA induced potent serum antibody responses against homologous H1 or H5 HAs, but did not stimulate strong T cell responses prior to challenge. However, animals vaccinated with MVA encoding influenza antigens made strong virus-specific CD4+ and CD8+ T cell responses within the first 7 days of H1N1pdm infection, while animals vaccinated with MVA encoding irrelevant antigens did not. There was little or no H1N1pdm replication in animals that received vaccines encoding H1 (homologous) HA, while in contrast, the vaccine encoding only NP from an H5N1 virus provided no protection. Surprisingly, shedding of H1N1pdm was reduced in animals vaccinated with MVA encoding HA and NP from an H5N1 isolate. This partial protection was associated with crossreactive antibodies capable of binding H1 HA protein and eliciting antibody-dependent cellular cytotoxicity (ADCC) effector functions from NK cells. Conclusions Our results suggest that ADCC may play a previously unrecognized role in heterosubtypic immunity to influenza. Vaccines optimized to induce cross-reactive “ADCC antibodies” may provide an important measure of protection against emerging antigenic variants, including emerging pandemic viruses, when NAbs are ineffective. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L39 L E C TU R E A BSTRAC TS SPA502 OMEGA Mva-based influenza vaccines – bringing these viral vectors from bench to bedside de Vries, Rory Dylan (1); Kreijtz, Joost (1); Sutter, Gerd (2); Osterhaus, Albert (1); Rimmelzwaan, Guus (1) 1: Viroscience department, Erasmus MC, Rotterdam, the Netherlands; 2: LMU, Munich, Germany Conventional influenza vaccines contain inactivated viruses or components thereof and have been used for over 50 years. They form the cornerstone of the seasonal influenza vaccination campaigns organized to effectively protect high-risk patients against influenza annually. In contrast, executing an effective vaccination campaign against a pandemic outbreak of influenza is a complex challenge. Pandemic influenza vaccine development suffers from many hurdles that complicate the production, distribution and timely availability of sufficient amounts of vaccines with MVA-BASED INFLUENZA VACCINES – BRINGING THESE VIRAL VECTORS FROM BENCH TO BEDSIDE good immunogenicity. Several of the these hurdles have been overcome by the use of reverse genetics for vaccine Rory D. de Vries [email protected] strain construction, the availability of cell-culture based production platforms and the development and registration Joost Kreijtz PhD, Viroscience lab, the Rotterdam, The Netherlands of several adjuvants. To address hurdles in pandemic influenza vaccine development new vaccine platforms are Guus Rimmelzwaan PhD, Viroscience lab, Rotterdam, The Netherlands Gerd Sutter PhD, LMU, Munich, Germany explored and under development. A promising platform is that of viral vector vaccines such as adenoviral vectors Albert Osterhaus PhD, Viroscience lab, Rotterdam, The Netherlands and poxviral vectors. In the last category, Modified Vaccinia virus Ankara (MVA) is a promising candidate. Conventional influenza vaccines contain inactivated viruses or components thereof and have been used for over 50 years. They form the cornerstone of the seasonal influenza vaccination campaigns organized to effectively MVA is a replication originally tested as safe alternative for the traditional poxvirus vaccine. It is protect high-risk patients against influenzadeficient annually. Inpoxvirus, contrast, executing an effective vaccination campaign against a pandemic outbreak of influenza is a complex challenge. Pandemic influenza vaccine development being evaluated as a vaccine platform for different infectious diseases and as a therapeutic vaccine. These studies suffers from many hurdles that complicate the production, distribution and timely availability of sufficient amounts of vaccines good immunogenicity. Several of the these haveevaluation. been overcome The by theavailable use of are in with various phases of pre-clinical andhurdles clinical data demonstrate that the vector is highly reverse genetics for vaccine strain construction, the availability of cell-culture based production platforms and the development and registration of several adjuvants. To address the hurdles in pandemic influenza vaccine immunogenic, even in the presence of pre-existing immunity to the vector. development new vaccine platforms are explored and under development. A promising platform is that of viral vector vaccines such as adenoviral vectors and poxviral vectors. Invaccines, the last category, Modified Vaccinia virus To construct recombinant MVA-vector the hemagglutinin (HA) gene can be cloned into the MVA- genome Ankara (MVA) is a promising candidate. through homologous recombination. This was done for the HA gene of influenza virus A/Vietnam/1194/04 (H5N1), MVA is a replication deficient poxvirus, originally tested as safe alternative for the traditional poxvirus vaccine. It a highly pathogenic influenza mice and cynomolgus macaques the MVA-H5 vaccine proved to be safe is being evaluated as a vaccine platform avian for different infectious virus. diseasesIn and as a therapeutic vaccine. These studies are in various phases of pre-clinical and clinical evaluation. The available data demonstrate that the and it induced immunity against homologous vector is highly immunogenic, evensterile in the presence of pre-existing immunity to the vector. and heterologous challenge viruses. Because of its favourable and excellent safety profile(HA) MVA a bepromising candidate as a future pandemic influenza vaccine To constructproperties recombinant MVA-vector vaccines, the hemagglutinin geneiscan cloned into the MVAgenome through homologous recombination. This was done for the HA gene of influenza virus production platform. A/Vietnam/1194/04 (H5N1), a highly pathogenic avian influenza virus. In mice and cynomolgus macaques the MVA-H5 vaccine proved to be safe and it induced sterile immunity against homologous and heterologous challenge viruses. Because of its favourable properties and excellent safety profile MVA is a promising candidate asFor a future influenza vaccine production thepandemic further development the platform. MVA-H5 was adjusted to make it suitable for use in humans and in 2013/2014 For the further development the MVA-H5 was adjusted to make ittrial suitable for use in humans andResults in 2013/2014 the first-in-man phase I/II clinical was conducted. obtained indicate the first-in-man phase I/II clinical trial was conducted. Results obtained indicate that the vaccine is safe and immunogenicimmunogenic in humans and holdsin promise as an influenza vaccine candidate. humans and holds promise as an influenza vaccine candidate. that the vaccine is safe and Figure: Clinical trial layout TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L40 L E C TU R E A BSTRAC TS SPA503 OMEGA Specific induction of neutralizing antibodies against HA, and T cell responses against conserved influenza antigens Grødeland, Gunnveig (1); Mjaaland, Siri (2); Baranowska, Marta (1); Fredriksen, Agnete (1); Bogen, Bjarne (1) 1: University of Oslo, Norway; 2: Institute of Public Health, Norway Background Current influenza vaccines are mostly aiming at the induction of specific neutralizing antibodies. While these are important for protection against a particular strain, T cells can recognize epitopes that will offer a broader protection against influenza. We have previously developed a DNA format in which antigens can be targeted specifically to receptors on antigen presenting cells (APCs). Here, we have investigated whether targeting to different receptors can polarize the immune system to different arms of immunity. The aim is thus to construct vaccines that specifically can induce the best suited type of immune responses against a particular influenza antigen. Methods We have constructed DNA vaccines where influenza antigens are bivalently targeted to Major Histocompatibility Complex (MHC) class II molecules or various chemokine receptors (CCR1/3/5) on antigen presenting cells (APCs) in mice. The DNA encoded vaccine molecules are homodimers, each chain consisting of a targeting unit, a dimerization unit, and an antigen. Results A single DNA immunization in mice with MHC class II-targeted hemagglutinin (HA) can induce long-lasting neutralizing and protective antibodies against influenza. By contrast, targeting of HA to CCR1/3/5 will predominantly induce protective CD8+/Th1 responses. In order to fully take advantage of the targeting dependent polarization, we constructed targeted vaccines encoding internal influenza antigens. Again, we found that the polarization of protective immune responses was dependent on the selection of receptor on APCs. Substitution of influenza antigens with ovalbumin (OVA) further indicated that the polarization of immune responses holds true for a variety of antigens. Conclusions Taken together, the results demonstrate that vaccination can be tailor-made to induce a particular phenotype of adaptive immune responses by specifically targeting different surface molecules on APCs. This could be used to develop vaccines that specifically induce high levels of neutralizing antibodies against HA, while simultaneously inducing high levels of CD8+ T cells against conserved internal influenza antigens. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L41 L E C TU R E A BSTRAC TS SPA504 OMEGA Evaluation of heterosubtypic immune responses in older people following pre-pandemic H5N1 influenza vaccination M Levine (1)*, K Nicholson (2), S Batham (2), D Wang (1), B Dighero-Kemp (1), ZN Li1, V Veguilla (1), F Liu1, XH Lu (1), J Katz (1). 1: Centers for Disease Control and Prevention, Atlanta, Georgia, United States; 2: Infectious Disease Unit, University Hospitals Leicester, United Kingdom Background Vaccination is the primary public health measure to control seasonal and pandemic influenza. However, vaccine responses may be influenced by host factors including age and levels of baseline antibodies. Previously, it was demonstrated that a proportion of older adults exhibited low baseline serum antibody titers to H5N1 virus. We evaluated the impact of baseline H5 antibody on the outcome of H5N1 vaccine responses in older adults and compared antibody responses with younger adults that received H5N1 vaccine; the possible virus priming history of vaccinees was investigated by examining the cross-reactive antibody responses to a panel of historic H1N1 viruses. Materials and Methods Older adults (64-81 yrs, n=27) and young adults (19-39 yrs n=20) received two doses of subvirion H5N1 vaccine (A/Vietnam/1194/2004 NIBRG14) with MF-59 adjuvant. Sera were tested by HI and MN assays against H5N1 vaccine virus, and by HI against a panel of H1N1 viruses (BPL inactivated A/SC/1/18 RG virus, A/MT/43, A/FM/1/47, A/USSR/90/77, A/TW/1/86, A/NC/20/99, and A/MX/4108/09). Antibody cross adsorption studies were conducted with magnetic beads and Luminex® multiplex assays using rHAs from the above subtypes. Results To compare the effect of priming, older adults were divided into 2 subgroups based on their baseline HI titers to H5N1: primed (HI≥8, n=11) and unprimed (HI<8, n=16). After one dose of H5N1 vaccine, primed older adults mounted significantly higher HI and MN responses (91% achieved titer ≥40 by HI, 73% ≥40 by MN), than unprimed older adults (6% ≥40 by HI, 13% ≥40 by MN) and young adults (30% ≥40 by HI, 15% ≥40 by MN), and similar to those in young adults after 2 doses of vaccine (80% ≥40 by HI, 70% ≥40 by MN). To better understand the priming effect, sera from older and young adults were tested by HI with 8 H1N1 viruses circulated from 1918 to 2009; the age range of older adults was consistent with exposure to H1N1 viruses early in life. For older adults, titers to A/SC/1/18 and A/MT/43 viruses were significantly higher in primed compared with unprimed group, suggesting that these priming viruses contributed to the baseline H5 antibody titer. Younger adults exhibited priming by more modern era viruses including A/TW/1/86 and A/NC/20/99. Primed elderly were also more likely to seroconvert to H1N1 viruses following H5N1 vaccination than either unprimed older or younger adults. Analysis of antibody adsorption studies is ongoing to determine the effect of priming on the quality of the H5N1 vaccine response. Conclusions Compared with unprimed young and older adults, older adults with a baseline H5N1 titer mounted robust antibody responses to adjuvanted H5N1 vaccine after a single dose. This study provides further understanding of effects of priming on vaccine responses that will inform better vaccination strategies. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L42 L E C TU R E A BSTRAC TS SPB5: GENETICS AND EVOLUTION OF VIRUS AND HOST SPB501 ALFA Two independent evolutionary pathways of HPAIV Stech, Olga; Veits, Jutta; Abdelwhab, Sayed; Wessels, Ute; Mettenleiter, Thomas C.; Stech, Juergen Friedrich-Loeffler-Institut, Germany Background HPAIV develop from low-pathogenic precursors of hemagglutinin (HA) serotypes H5 or H7, requiring the acquisition of a polybasic HA cleavage site (HACS). However, introduction of a polybasic HACS into LPAIV does not necessarily result in high virulence for chicken indicating that, beside the essential polybasic HACS, the existence of additional virulence determinants. Those additional adaptive changes might accumulate in the low-pathogenic precursors during their circulation in gallinaceous poultry prior to emergence of an HPAIV. Since this evolutionary process is not well understood, we aimed to unravel the genetic determinants which, beside the polybasic HACS, are required for transformation of LPAIV into HPAIV. Results To select a minimal gene constellation sufficient for a highly pathogenic virus, we co-transfected plasmids coding for all eight genes from an H5N1 HPAIV and seven, except HA, from an H5N1 LPAIV, and used the supernatant to infect chickens. Shed reassortants carried the HPAIV PB2, NP, HA, NA, and M genes; a virus reconstituted by reverse genetics, was highly pathogenic and transmissible like the wild-type. Furthermore, by stepwise exchange of the HPAIV genes, we eventually found that an LPAIV reassortant carrying only the HPAIV HA and NA contains the minimum set of HPAIV genes enabling high virulence, albeit at a prolonged mean death time. Furthermore, we abolished the NA stalk deletion leading to considerably reduced lethality and no transmission in chicken. Conversely, an LPAIV reassortant carrying only the HPAIV HA but the LPAIV NA with engineered stalk deletion displayed 100% lethality both after primary or contact infection. Therefore, the NA stalk deletion is an essential virulence determinant beside the polybasic HACS. Remarkably, the LPAIV NA which contains no stalk deletion, introduced into the H5N1 HPAIV exclusively, did not reduce virulence and transmission compared to the HPAIV parent virus. Taken together, the HPAIV HA and NA are sufficient for high virulence in an LPAIV background. Moreover, the NA stalk deletion along with the polybasic HACS form a minimum set of virulence determinants. However, our selection experiment in chickens, infected with transfection supernatants, indicates that beside the HPAIV HA and NA, the PB2, NP, and M enable maximal virulence. For that reason, we surveyed all public PB2, NP, and M1 protein sequences from Genbank and GISAID. Data mining revealed that there are natural HPAIV strains corresponding to the here described HA/NA reassortant, confirming the HA with polybasic HACS and the NA with stalk deletion as a minimum set of virulence determinants. However, natural HPAI strains without stalk deletion but with several NP mutations from the HPAIV studied, corresponding to the NA/ HPAIV reassortant, indicate an alternative set of virulence determinants. Conclusions Therefore, those two sets of virulence determinants indicate two independent pathways of evolution of LPAIV into HPAIV. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L43 L E C TU R E A BSTRAC TS SPB502 ALFA Dynamics of influenza virus reassortment in a co-infected host Tao, Hui; Steel, John; Lowen, Anice Emory University, United States of America Background The segmented nature of the influenza virus genome allows reassortment between co- infecting viruses. This process of genetic exchange combines with genetic drift to generate the extensive diversity of circulating influenza viruses. The importance of reassortment to public health is clear from its role in the emergence of a number of epidemiologically important viruses, including novel pandemic and epidemic strains. To gauge its impact on withinhost genomic variation, we tracked reassortment in co- infected guinea pigs over time and given matched or discordant doses of co-infecting viruses. Methods To ensure unbiased detection of reassortants, we used parental viruses of equivalent fitness that differ only by noncoding nucleotide changes. Silent mutations were introduced into influenza A/Panama/2007/1999 (H3N2) virus to generate a variant referred to as Pan/99var virus. These mutations allow differentiation of each genome segment from those of the Pan/99 wild type (wt) virus using high resolution melt analysis. The mutations introduced did not attenuate Pan/99var virus relative to the Pan/99wt virus; thus, all parental and reassortant progeny arising from mixed infection between Pan/99wt and Pan/99var viruses are of equivalent fitness. Co-infections with these two well-matched viruses were performed in a guinea pig model and virus was sampled through the collection of nasal washes. To evaluate the intra-host diversity achieved through reassortment, the full genotypes of clonal virus isolates derived from nasal washes were determined. Results At a relatively low dose of 102 PFU of each virus, one parental virus was absent from each guinea pig throughout the time course, indicating the presence of a bottleneck. With an intermediate dose of 103 PFU, genomic diversity present in nasal wash samples increased from day 1-3 post-infection (p.i.) and then declined by day 6 p.i. as the virus was cleared. With a high dose of 106 PFU, however, reassortment levels were high (avg. 59%) on day 1 p.i. and remained stable. Even late in the course of infection, parental viruses were not eclipsed by reassortants, suggesting that a uniformly high multiplicity of infection was not achieved in vivo. When the relative doses of parental viruses were altered from 1:1 to approximately 1:10, the frequency of reassortant progeny was not reduced. The spectrum of genotypes produced changed significantly, however, with gene segments from the more abundant parental strain predominating within reassortant genomes. Conclusions Our data indicate the importance to reassortment efficiency of total dose, relative dose and time after infection and reveal the potential for reassortment to contribute to intra- host diversity in mixed influenza virus infection. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L44 L E C TU R E A BSTRAC TS SPB503 ALFA Mapping the antigenic drift of human influenza A(H1N1) and B viruses since the 1940s Koel, Björn Erasmus MC, Netherlands, The Background Influenza viruses are able to evade humoral immunity built up in the human population during the annual influenza epidemics by accumulating mutations in the surface proteins haemagglutinin and neuraminidase. This process is called antigenic drift and is thought to facilitate the annual return of these viruses. For the annual update of the influenza vaccine composition, the antigenic reactivities of recent epidemiological strains are compared with candidate vaccine strains using haemagglutination inhibition (HI) assays. For influenza A(H3N2) viruses, the antigenic drift since their introduction in 1968 was visualised using the method of antigenic cartography (Smith DJ, Lapedes AS, Jong JC de, et al. Mapping the antigenic and genetic evolution of influenza virus. Science 2004;305:3716). The goal of the present study was to map the antigenic evolution of human influenza A(H1N1) and B viruses since the 1940s. Methods Thirty-nine influenza A(H1N1) viruses from the periods 1947 to 1957 and 1977 to 2009, and 24 influenza B virus strains from the period 1949 to 2011, isolated in eggs or cell culture, were selected and in part used to prepare postinfection antisera in ferrets. The antisera were titrated in HI assays against the mentioned 39 influenza A(H1N1) and 24 influenza B viruses, using turkey erythrocytes in a WHO standard protocol. Results Like influenza A(H3N2) virus, the antigenic evolution of influenza A(H1N1) and B virus proceeded in a punctuated fashion rather than gradually. Among both the influenza A(H1N1) and the influenza B viruses, a number of clusters could be distinguished, the strains of the phylogenetic B/Yamagata16/88 line forming a single cluster. The antigenic profiles moved away from the strains circulating in the 1940s, though not as straightforward as with influenza A(H3N2) viruses. The changes occurred at a lower rate compared with influenza A(H3N2) viruses, that seems in line with the lower incidence of influenza A(H1N1) and B virus infections in the human population compared with influenza A(H3N2) viruses. Conclusions Influenza A(H1N1) and B viruses evolved antigenically in a punctuated way. Their antigenic profiles were found to be more stable than those of influenza A(H3N2) viruses, a feature that may be related to the lower levels of circulation of the influenza A(H1N1) and B viruses compared with influenza A(H3N2) viruses. The results provide background information for the selection of influenza virus strains for vaccine production. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L45 L E C TU R E A BSTRAC TS SPB504 ALFA High co-infection rates and multiplicity reactivation facilitate incomplete gene segment packaging in vivo Brooke, Christopher Byron National Institute of Allergy and Infectious Diseases, United States of America Background The influenza A virus (IAV) genome is divided into eight distinct RNA segments, all of which are required to encode a productive infection. IAV maintains a highly specific packaging mechanism that ensures that a single copy of each gene segment is selectively packaged into budding virions, however the efficiency of this process is not known. We recently reported that the vast majority of infectious virions fail to express gene products from one or more segments, suggesting that most virions carry incomplete genome sets. These findings raised the possibility that incomplete genome packaging might be beneficial to the virus under some conditions. Consistent with this hypothesis, we identified a single substitution (F346S) in the NP of PR8 that enhanced replication and transmissibility in guinea pigs while selectively reducing packaging of the NA gene segment. Methods We assessed gene packaging rates both by quantitative RT-PCR on both highly purified virus preparations and guinea pig nasal wash, and by measuring the fraction of infectious virions capable of expressing different gene products by flow cytometry. To measure the in vivo co-infection frequency in guinea pigs, we exploited the observation that only a minor fraction of virions in nasal wash co-expressed HA, NA, and NP when used to infect MDCK cells ex vivo under low MOI conditions, but that these co-expression frequencies increased predictably as the MOI increased due to complementation. We compared these ex vivo co-expression frequencies to the co-expression frequencies that we observed in cells isolated from guinea pig nasal turbinates at different times post- infection. We also examined the effect of the NP:F346S mutation on burst size and multiplicity reactivation in vitro. Results We observed high frequency co-infection within the upper airways of infected guinea pigs within the first 48 hours of infection, despite using a relatively modest inoculum dose (500 TCID50). The fraction of NP:F346S virions harboring incomplete genome sets complemented each other under high MOI conditions, resulting in productive infection. Conclusions IAV gene packaging is more variable than previously thought, and reduced gene packaging rates can be associated with increased in vivo fitness and transmissibility. The high frequency of co-infection in vivo allows particles carrying incomplete sets of gene segments to propagate through complementation. Under these conditions, the costs of incomplete packaging are minimized while the benefits, such as increased sexual recombination through reassortment, are maximized. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L46 L E C TU R E A BSTRAC TS SPA6: EVALUATION OF VACCINE SAFETY AND EFFECTIVENESS SPA601 OMEGA Live attenuated vaccines against potentially pandemic influenza viruses: rationale for genetic stability Kiseleva, Irina (1); Larionova, Natalie (1); Dubrovina, Irina (1); Bazhenova, Ekaterina (1); Fedorova, Ekaterina (1); Isakova-Sivak, Irina (1); Kuznetsova, Victoria (1); Stukova, Marina (2); Erofeeva, Marianna (2); Pisareva, Maria (2); Desheva, Julia (1); de Jong, Jorgen (3); Ross, Ted (4); Flores, Jorge (5); Tsvetnitsky, Vadim (5); Rudenko, Larisa (1) 1: Institute of Experimental Medicine, St Petersburg, Russian Federation; 2: Institute of Influenza, St Petersburg, Russian Federation; 3: Centre for Infectious Disease Control, RIVM, Bilthoven, the Netherlands; 4: Vaccine & Gene Therapy Institute of Florida, FL, USA; 5: Program for Appropriate Technologies in Health, Seattle, WA, USA Background Genome stability is one of the main properties of any live attenuated influenza vaccine (LAIV). This study describes the results of virus shedding and clinical isolates’ testing of a double-blinded randomized placebo-controlled phase I clinical trials of LAIVs against potentially pandemic influenza viruses in healthy adults. Methods LAIV candidates were generated in eggs by classical reassortment of potentially pandemic influenza viruses H2N2, H5N1 and H7N3 with A/Leningrad/134/17/57 (H2N2) master donor virus (MDV) (H2-LAIV, H5-LAIV and H7-LAIV, respectively). All LAIV candidates retained temperature sensitive (ts) and cold-adapted (ca) phenotypes of the MDV and were attenuated for ferrets. For each vaccine tested 40 subjects were randomly distributed into two groups to receive two doses of either LAIV or placebo at a 3:1 vaccine/placebo ratio. The subjects were followed in an isolation unit for one week. Nasal swabs were examined for vaccine shedding by culturing in eggs or by PCR. Determination of ts/ca phenotypes of LAIV isolates was performed by titration in eggs at optimum, low and elevated temperatures. Nucleotide sequencing was performed using a Genetic Analyzer (Applied Biosystems). Results Vaccine virus detection. The majority of PCR- and eggs-positive specimens were detected for the first day following vaccination. LAIVs tested shed vaccine virus after the first vaccination at different rate from 13.3% (H7-LAIV) to 33.3% (H5-LAIV) and 39.3% (H2-LAIV), respectively. After revaccination LAIV virus was isolated in 0% (H7-LAIV), 20.7% (H5LAIV) and 29.6% (H2-LAIV) of vaccinated subjects, respectively. PCR method demonstrated higher sensitivity then routine virus isolation in eggs. The percentage of positive subject varied from 90.0% (dose 1 of H5-LAIV) to 74.1% (dose 2 of H2-LAIV). In general, no significant differences between the first and the second vaccinations regarding detection of LAIV virus were revealed. None of the placebo recipients had detectable shed vaccine virus. Phenotype of recovered viruses. The attenuated phenotype of LAIV isolates has been proven in experiments in eggs. All viruses isolated from study subjects retained the ts/ca phenotypic characteristics of the MDV. Confirmation of the presence of attenuating mutations in recovered viruses. All clinical isolates tested were shown to preserve all attenuating mutations described for MDV. These data suggest high level of vaccine virus genetic stability after replication in humans. During manufacture process no additional mutations occurred in the genome of H2- LAIV. In contrast, the acquisition of additional mutations in the HA of manufacture vaccine lots of H5-LAIV (two) and H7-LAIV (one) was detected, but they didn’t affect their attenuated phenotype. Conclusions Our clinical trials revealed phenotypic and genetic stability of the LAIV viruses recovered from those volunteers who shed vaccine virus. In addition, vaccine virus was not detected in placebo group supporting a notion for the lack of person-to-person transmission of the live vaccine virus. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L47 L E C TU R E A BSTRAC TS SPA602 OMEGA Cellular immune responses elicited after intranasal influenza vaccination in children, a clinical trial Mohn, Kristin G-I (1); Bredholt, Geir (1); Brokstad, Karl (1); Aarstad, Hans Jørgen (2); Pathirana, Rishi (1); Tøndel, Camilla (2); Cox, Rebecca Jane (1,2) 1: University of Bergen, Norway, Norway; 2: Haukeland University hospital, Bergen, Norway Background Children represent the main source of spread of influenza infection in the community. The palatine tonsils have a central role in protecting the upper respiratory tract and are a site for activation of protective immune responses towards respiratory pathogens such as the influenza virus. Despite 10 years on the global market, there exists no good correlate of protection after LAIV immunization. The aim of this study was to investigate local and systemic immune responses with focus on cellular immunity elicited toward the vaccine in young children, and to identify better efficacy/protective markers. Methods Fifty-five children aged 2-17 (median 4) years old, scheduled for elective tonsillectomy, were recruited from the EarNose-Throat clinic. Thirty-nine children were immunized with a seasonal live attenuated influenza vaccine (LAIV), of whom 30 children received 2 doses of vaccine, and 16 children were controls. Two children withdrew after the first dose. Influenza specific immune responses were evaluated using a direct antibody secreting cell, memory B cell (MBC) and IFN-γ enzyme- linked immunosorbent spot assay (ELISPOT). CD4+ Th1 cells were evaluated by intracellular cytokine staining for INF-γ, IL-2 and TNFα using multi parametric flow cytometry. The serological response was measured by HAI assay. Results The LAIV vaccine was easily administered and well tolerated, and we saw no significant changes in cytokine or chemokine profile in the plasma. We observed a great degree of strain variation in the immune response, with a difference between the influenza A and B groups. Overall the B strain elicited the most significant increases in immune responses. Influenza specific INF-γ secretion increased after vaccination and was maintained one-year post vaccination. The increase in MBC response was dependent on the priming status of the child. Primed children had high levels of MBC, without further increase after vaccination, suggesting a biological threshold in the MBC response. The unprimed children showed a significant increase in MBC for H3N2 strain after the first vaccine dose with an additional boosting after the second dose. Flow cytometry analysis showed a significant increase in the influenza specific Th1 T-cell cytokine production (INF-γ, IL-2 and TNF-a) after the second dose. Conclusions This study is unique since it is studying a relative large number of very young children and many samples have been collected constituently during the one-year prospective study. The LAIV vaccine elicited long-lasting cellular immune responses in young children. This vaccine may represent a good alternative for immunization of high-risk children against seasonal influenza in Europe, and may possibly provide some protection against the threat of a new pandemic before a vaccine is available. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L48 L E C TU R E A BSTRAC TS SPA603 OMEGA Effectiveness of influenza vaccination in preventing hospitalizations in children in Hong Kong, 2009-13 Cowling, Benjamin; Chan, Kwok-Hung; Feng, Shuo; Chan, Eunice; Peiris, Malik; Chiu, Susan The University of Hong Kong, Hong Kong S.A.R. (China) Background Influenza vaccination is widely recommended every year to protect individuals against influenza virus infection and illness. There are few published estimates of influenza vaccine effectiveness against hospitalization in children or from subtropical regions. Methods We conducted a test-negative year-round study between October 2009 and September 2013, recruiting children 6 months to 17 years of age admitted to two hospitals in Hong Kong with a febrile acute respiratory infection. Cases were tested for influenza A and B and conditional logistic regression was used to estimate vaccine effectiveness comparing influenza vaccination history of the trivalent influenza vaccine (TIV) among cases testing positive versus negative for influenza, adjusting for age and sex and matching by calendar week of recruitment. Results Overall vaccine effectiveness against hospitalization with laboratory- confirmed influenza A and B was estimated to be 61.7% (95% CI: 43.0%, 74.2%). The estimated vaccine effectiveness against hospitalization with confirmed influenza A(H3N2) was 36.6% (95% CI: -25.5%, 67.9%) compared to 71.5% (95% CI: 39.4%, 86.6%) for A(H1N1)pdm09 and 68.8% (95% CI: 41.6%, 83.3%) for B. Vaccine effectiveness was lower for children 6m to 2y of age (34.1%; 95% CI: -27.3%, 65.9%) compared to children 3-5y (70.4%; 95% CI: 36.3%, 86.3%) and 6-17y (66.1%; 95% CI: 25.8%, 84.5%). Conclusions Vaccine effectiveness against hospitalization in children varied from year to year, but was moderate to high overall even in an area with influenza activity throughout the year. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L49 L E C TU R E A BSTRAC TS SPA604 OMEGA Influenza revaccination with MF59®-adjuvanted or nonadjuvanted trivalent inactivated seasonal influenza vaccines in 30–96 month-old children primed two years previously Vesikari, Timo (1); Forsten, Aino (1); Arora, Ashwani (2); Tsai, Theodore (2); Clemens, Ralf (2) 1: University of Tampere Medical School, Tampere, Finland; 2: Novartis Vaccines and Diagnostics, Cambridge, MA, USA. Background After showing that MF59®-adjuvanted influenza vaccine is significantly more efficacious than non-adjuvanted vaccine against influenza in children (Vesikari et al. NEJM 2011;365:1406–16), we followed up participants after interruption by the 2009 A/H1N1 pandemic. Methods In this phase IIIb, observer-blind, extension study at 15 sites across Finland, 197 children (29 aged 30–36 months and 168 aged 36–96 months) vaccinated two years previously with placebo, or two half or full doses of trivalent MF59®adjuvanted influenza vaccine (aTIV, Fluad®) or non-adjuvanted vaccine (TIV, Agrippal®) were revaccinated with 20102011 season aTIV or TIV. Immunogenicity was assessed by hemagglutination inhibition (HI) against 2010–2011 season antigens in sera obtained at Day 1, Day 22 and Day 181. Parents reported reactogenicity on diary cards. Results Two years after priming, aTIV- and TIV-primed groups (N=166, excluding subjects previously treated with placebo) had similar HI titers for A/H1N1 and B strains, but aTIV-primed had higher A/H3N2 titers than TIV-primed. Revaccinating aTIV- or TIV-primed with aTIV elicited robust responses to all three strains, higher for A/H3N2 and B strains in aTIVaTIV than TIV-aTIV. TIV vaccination in aTIV-primed subjects produced higher titers than in TIV-primed against the A/ H3N2 and B strains, but similar responses to A/H1N1. Patterns of responses were similar when analyzed in sub-sets of children not vaccinated with pandemic or seasonal vaccine since priming. High titers persisted to Day 181 in most cases, except against B strain in TIV-primed subjects. Reactogenicity was slightly higher for aTIV than TIV, but generally acceptable, consisting of mainly mild or moderate reactions expected of childhood vaccinations, with no vaccine-related SAEs. Conclusions Revaccinating aTIV-primed children with either aTIV or TIV produced higher responses than after TIV-priming, with acceptable tolerability. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L50 L E C TU R E A BSTRAC TS SPB6: RISK MANAGEMENT AND MITIGATION SPB601 ALFA Risk factors for severe outcomes and impact of vaccination on pneumonia and influenza within active US military populations 2000-2012 Van Kerkhove, Maria D (1); Cooper, Michael J (2); Erik-Cost, Angelia A (2); Sanchez, Jose L (2); Riley, Steven (1) 1: Imperial College London, Department of Infectious Disease Epidemiology, United Kingdom; 2: Armed Forces Health Surveillance Center, Global Emerging Infections Surveillance and Response System Division, Silver Spring, Maryland, USA Background Respiratory infections are responsible for up to 350,000 of medical encounters each year among US military personnel. Methods We obtained data on 15,210 hospitalizations for pneumonia and influenza (P&I) between 01/01/00 and 31/12/12. From these, we identified 335 SARI episodes using standard case definitions. We evaluated the effect of demographic and occupational characteristics, comorbid conditions, and history of influenza vaccination on the risk of a hospitalized P&I case becoming a SARI case. We also evaluated the risk of SARI and the length of time since vaccination. Results The median age of subjects was 22 years (range, 17-64) and subjects were predominantly male (89.5%). Risk factors for developing SARI included age (≥45 years, RR=1.8, 95% CI 1.2-2.7), American Indian or Alaskan Native ethnicity (RR=3.0, 95% CI 1.0-8.7), and service in the Air Force (RR=1.7, 95% CI 1.3-2.3), Coast Guard (RR=2.7, 95% CI 1.3-5.3) or Navy (RR=1.4, 95% CI 1.0-2.0). Being male, born in mainland US (vs outside of mainland US) and recent vaccination (within 180 days of episode) were protective against developing SARI. Among comorbid conditions, risk factors for SARI included chronic or liver disease (RR=5.7, 95% CI 4.5-7.1), diabetes (RR=2.8, 95% CI 1.7-4.6), immune disorders (RR=2.6, 95% CI 1.1-6.1), obesity (RR=1.76, 95% CI 1.26-2.46), cancer (RR=1.7, 95% CI 1.3-2.2), and chronic obstructive pulmonary disease (RR=1.5, 95% CI 1.16-1.96). Male gender (RR=0.7, 95% CI 0.5-0.9) and influenza vaccination (RR=0.7, 95% CI 0.5-0.97) remained significantly protective and, while serving in the Coast Guard (RR=2.1, 95% CI 1.1-4.1) or Air Force (RR=1.6, 95%CI 1.2-2.1) and renal or liver disease (RR=5.0, 95% CI 3.8-6.5) were significantly associated with developing SARI in the multivariate model. Our results also suggest that the closer the vaccination was to hospitalization, the less likely the individual was to develop SARI, with substantially reduced odds of SARI for delays of 1 vs. 6 months). Conclusions These data suggest that timing of influenza vaccination is critical in reducing severity of P&I hospitalizations; additional analysis of delays in vaccination may impact future military immunization policy. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L51 L E C TU R E A BSTRAC TS SPB602 ALFA Southern hemisphere influenza and vaccine effectiveness research and surveillance (SHIVERS) in New Zealand Huang, Q. Sue (1); Turner, N. (2); Baker, MG (3); McArthur, C (4); Williamson, D (1,2,4); Grant, C (2); Roberts, S (4); Aley, D (4); Trenholme, A (5); Conroy, C (5); Taylor, S (5); Lawrence, S (5); Davey, K (5); Wood, T (1); Bissielo, A (1); Radke, S (1); Bandaranayake, D (1); Seeds, R (1); Mackereth, G (1); Todd, A (1); Pierse, N (3); Thomas, P (6); Webby, R (6); Thompson, M (7); Duque, J (7); Gross, D (7); Widdowson, MA (7) 1: Institute of Environmental Science and Research, New Zealand; 2: University of Auckland, Auckland, New Zealand; 3: University of Otago, Wellington, New Zealand; 4: Auckland District Health Board, Auckland, New Zealand; 5: Counties Manakau District Health Board, Auckland, New Zealand; 6: WHO Collaborating Centre, St Jude Children’s Research Hospital, Memphis, USA; 7: Centers for Disease Control and Prevention (CDC), Atlanta, USA Background The “Southern Hemisphere Influenza and Vaccine Effectiveness Research and Surveillance” (SHIVERS) project was established in 2012 for a five year period. It is a multi-centre and multi-disciplinary collaboration. The SHIVERS project has 9 objectives: 1∗) understand severe acute respiratory infections; 2∗) assess influenza vaccine effectiveness; 3∗) investigate interaction between influenza and other respiratory pathogens; 4∗) ascertain the causes of respiratory mortality; 5∗) understand non-severe respiratory illness; 6) estimate influenza infection through a serosurvey; 7∗) determine influenza risk factors; 8) study the immune response to influenza; and 9) determine the healthcare and societal economic burden and vaccine cost-effectiveness of influenza. Materials and methods To address these objectives, we established two surveillance systems for the 838,000 residents living in central, east and south of Auckland: 1) hospital- based: active, prospective, continuous, population-based surveillance for all hospitalized severe acute respiratory infection (SARI) cases and a proportion of non-SARI respiratory cases, all ICU admissions and deaths caused by influenza and other respiratory pathogens; and 2) sentinel (18 providers) general practice-based: active, prospective, population-based surveillance (covering 12% of the catchment population) for influenza-like illness (ILI) cases caused by influenza and other respiratory pathogens. A case test-negative design was used to estimate influenza vaccine effectiveness in preventing SARI and ILI. Results During the 2013 influenza season (29-April to 29-September 2013), influenza- associated SARI rates were highest at the extremes of age (122/100,000; 49/100,000; 72/100,000 and 69/100,000 population in persons aged <1; 1-4; 65-79 and ≥80 years respectively), in Pacific (51/100,000) and Maori (27/100,000) ethnic groups and those from the lowest socio-economic (SES) group (51/100,000). In contrast, influenza-associated general practice ILI consultation rates were highest in children aged 5-19 years (640/100,000) and 1-4 years (488/100,000), in Asian ethnic group (573/100,000) and those from the highest SES group (498/100,000). Influenza vaccination provided 52% (95%CI 3266) effectiveness against laboratory-confirmed influenza hospitalization and 56% (95%CI 34- 70) against laboratory confirmed influenza presenting to general practice. Conclusions Results from SARI and ILI surveillance of the 2013 influenza season showed contrasting socio-demographic patterns with inverse ethnic and deprivation gradients seen for influenza-associated ILI in sentinel practices compared with influenza-associated SARI in hospitals. Influenza vaccine appeared equally effective at preventing SARI and ILI, though the populations presenting with influenza are markedly different in general practices to those admitted to hospital. The hospital-based SARI and sentinel practice-based ILI surveillance systems will provide a research platform over the next three years to comprehensively investigate influenza epidemiology, virology, immunology and vaccine effectiveness. These results will enable SHIVERS to develop methods to improve clinical detection of influenza, measure the impact of vaccination, guide targeted vaccination delivery, inform vaccine design, optimize clinical management and laboratory diagnosis, identify risk factors, understand host immune responses and identify better immune diagnostic markers. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L52 L E C TU R E A BSTRAC TS SPB603 ALFA Extension of the United Kingdom Influenza Immunisation Programme 2013/2014 to Children and the Implications for High-Risk Group Uptake Blak, Betina (1); Rajaram, Sankarasubramanian (1); Steffey, Amy (2); Caspard, Herve (2) 1: AstraZeneca, London, United Kingdom; 2: AstraZeneca, Gaithersburg, MD, USA Background The Departments of Health of the United Kingdom (UK) extended the 2013/2014 influenza immunisation programme to children with a routine offer of vaccination to all 2- and 3-year-olds as well as geographical pilots for 4- to 11-year-olds. Children with high-risk conditions are part of the targeted groups in the schedule historically, but rates of vaccination in this population have been well below the elderly uptake rate until now. The aim of this study was to evaluate the impact of the influenza immunisation programme on vaccination rates in children with high-risk conditions. Methods All children aged 2 to 17 years on September 1, 2012 (for season 2012/2013) or September 1, 2013 (for season 2013/2014), with at least 12 months of prior medical history documented in the observational UK Clinical Practice Research Datalink (CPRD), were retained in this analysis. Administration of influenza vaccine was retrieved from immunisation, clinical, and therapy records between September 1 and December 31. High-risk conditions were defined prior to September 1 using operational definitions adapted from the specifications published by PRIMIS at the University of Nottingham. Vaccination rates were analyzed for each season using time to event methods. Results A total of 807,551 and 747,847 children aged 2 to 17 years were retained in the analysis for seasons 2012/2013 and 2013/2014, respectively. During season 2013/2014, 6.4% of all children presented with at least one high risk condition. The most frequent high risk conditions were asthma/chronic respiratory diseases (4.8%), followed by chronic heart diseases (0.9%), chronic neurological diseases (0.5%), and diabetes (<0.3%). These figures were similar for the 2012/2013 season, with 6.6% of all children presented with at least one high risk condition. Vaccination rates by age category as of December 31, 2012 and December 31, 2013, in children with and without high-risk conditions are presented in the table below: High-Risk Condition Age (years) No High-Risk Condition Season Season Season Season 2012/2013, % 2013/2014, % 2012/2013, % 2013/2014, % 2 to 3 39.2 59.2 1.0 42.1 4 to 8 40.4 43.5 1.1 3.0 9 to 17 39.7 40.8 1.3 2.5 Conclusions Extension of the 2013/2014 influenza immunisation programme to children sharply increased (40 percentage points) the vaccination rate for 2- to 3-year-olds without high-risk conditions. Vaccination rates also increased for children with high-risk conditions in all age categories, with the most profound increase (20 percentage points) in 2- to 3-year-olds. These results are consistent with those supported by ImmForm surveys and published by the UK public health agencies. This study was sponsored by MedImmune, biologicals arm of AstraZeneca. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L53 L E C TU R E A BSTRAC TS SPB604 ALFA Pandemic preparedness in Europe – five years on from the 2009 pandemic Brown, Caroline Sarah; Hegermann-Lindencrone, Michala WHO Regional Office for Europe, Denmark Background On 6 June 2014, it is the five year anniversary for the declaration of the H1N1 pandemic in 2009. It was the first pandemic for which countries had pandemic preparedness plans in place and for which sophisticated surveillance and monitoring systems existed. Substantial information was collected, new evidence became available and a broad range of national and international experiences were gained related to pandemic preparedness and response. Five years down the line, less than 10 of the 53 WHO European Member States have incorporate the new evidence and experiences gained by revising and publishing their national pandemic preparedness plans. Only one country has revised its plan after the publication of the new global guidelines for pandemic preparedness, i.e. the Pandemic Influenza Risk Management WHO interim guidance. Methods A review of those pandemic plans that have been revised and published subsequent to the pandemic in 2009 was performed to discover what has changed in pandemic plans in post- pandemic versions. Five plans out of seven published plans were included. Two were excluded because of translation issues. Results The main changes to the plans published after the pandemic in 2009 compared to earlier plans are that they are placing greater emphasis on flexibility and on a response that is proportionate with the risk. Plans are largely moving away from basing their response on WHO pandemic phases and several plans state that they are intended for use for pandemic response as well as response to other outbreaks. There is in general more emphasis on multisectoral work and on business continuity planning. Conclusions The experience from pandemic planning and the response to the 2009 pandemic is so substantial that other areas of preparedness are now benefitting from the work done and knowledge gained during the 2009 pandemic. Not only preparedness for outbreaks of other disease but also environmental preparedness etc is drawing from the lessons learned. It is important that all countries incorporate new evidence and national experience from the pandemic and publish their updated plans. By publishing plans, countries improve interoperability and support countries that may learn from these plans – and the plans are used as basis for generic preparedness to other health hazards. Sharing the new knowledge is fundamental to improve preparedness in Europe. Keywords Pandemic preparedness, Europe, pandemic plans16 SEPTEMBER 2014 TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L54 L E C TU R E A BSTRAC TS SPA7: MATERNAL IMMUNIZATION SPA701 OMEGA Flu vaccination of pregnant women in Kazakhstan Kuatbayeva, Ainagul Mukhanovna Research & Practice Center of Sanitary Epidemiological Expertise and Monitoring of the Agency of Consumers Rights Protection of Kazakhstan Republic, Kazakhstan Introduction In Kazakhstan, annually, 750,000 – 1,300,000 people are vaccinated against influenza (approximately 10% of the population), with free vaccination provided for: “frequently sick” children; persons >65 years-of-age; children in children’s homes and orphanages; and healthcare workers. The global morbidity of influenza among pregnant women during the H1N1-09 pandemic influenced the Kazakhstan Ministry of Health (MOH) to offer free vaccination to pregnant women in 2012. We studied the effectiveness of implementation of this policy. Methods Government vaccination records determined the numbers of women vaccinated and side effects. To determine the effectiveness of vaccination, we used the weekly monitoring data of the routine epidemiological surveillance system for acute respiratory virus infections (ARVI) and pneumonia morbidity and mortality among pregnant women. Sentinel surveillance and public health laboratory records were reviewed to determine influenza virus recovery from pregnant women. Results Prior to onset of the epidemic season of 2012/2013, >75,000 women were vaccinated, and prior to the 2013/2014 season, > 150,000 pregnant women were vaccinated. Comparing ARVI case rates in the 2013/2014 season with the 2012/2013 influenza season, the number of ARVI cases per 1,000 pregnant women decreased 1.8 times, i.e., 63.7 cases compared to 111.7 cases; pneumonia case-rates were reduced 2.4 times; and, the number of hospitalized pregnant women was reduced 2.2 times. No woman was reported to have had side effects from the vaccine. Influenza virus was not recovered from any vaccinated pregnant women In 2014, a scientific study was started in Almaty to assess the impact of ARVI and flu on the pregnancy course and health condition of children under one year in pregnant women who were vaccinated and pregnant women who were not vaccinated during pregnancy (data pending). Conclusions Vaccination of the future mothers against flu is an important and likely cost-effective way of reducing rates of ARVI due to influenza protecting two high-risk groups simultaneously – pregnant women and infants. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L55 L E C TU R E A BSTRAC TS SPA702 OMEGA The Norwegian Influenza cohort (NorFlu): immune responses in pdmH1N1 exposed versus non-exposed pregnant women Savic, Miloje (1,4); Laake, Ida (2); Dembinski, Jennifer (1,4); Tunheim, Gro (1,4); Oftung, Fredrik (1,4); Hungnes, Olav (3); Næss, Lisbeth (1); Trogstad, Lill (2); Cox, Rebecca (5); Mjaaland, Siri (1,4); Waalen, Kristian (3) 1: Department of Bacteriology and Immunology, Norwegian Institute of Public Health, Oslo, Norway; 2: Department of Vaccines, Norwegian Institute of Public Health, Oslo, Norway; 3: Department of Virology, Norwegian Institute of Public Health, Oslo, Norway; 4: KG Jebsen Centre for Influenza Vaccine Research, Oslo, Norway; 5: Influenza Centre at the University of Bergen, Bergen, Norway Background Short and long-term consequences of in utero exposure to influenza need detailed clarification. Furthermore, the impact of the specific immunological challenges in pregnancy on women’s responses to influenza infection is largely unknown. Two major aims that the Norwegian Influenza cohort (NorFlu) cohort will address are: 1) perinatal outcomes and children’s mental and cognitive development depending on mothers’ H1N1pdm09 exposure status, and 2) the correlation of risk factors for severe influenza in pregnancy and the effect on children’s immune response. The specific aim of this study was to analyze the correlation between humoral and cellular responses to influenza exposure and the risk of influenza illness symptoms. Methods In Norway, a cohort of pregnant women and their children, the Norwegian Influenza Pregnancy Cohort (NorFlu), was established during the influenza A H1N1 pandemic in 2009 (pdmH1N1). The cohort comprises about 3200 mother and child pairs of which 2600 paired biological samples were collected. Information on immunization, health and diseases is available from questionnaire data and national health registries. A nested case-control study among women who were not vaccinated against pdmH1N1 was initiated. Selection criteria for the cases were: last menstrual period between 1st May and 1st December (corresponding to the pregnancy in the period between 1st October and 31st December 2009, which was the main pandemic peak in Norway), and hemagglutination inhibition assay (HAI) titer values equal or above 20 HAI units. Controls were randomly selected among the women who were pregnant in the same time period, had a HAI titer of 0, and reported not feeling influenza illness symptoms. Results Based on the inclusion criteria 82 cases and control pairs were selected. The median value of the HAI titers for the cases was 40 (range from 20 to 320). The median age was 30 (age range: 19–41) for cases and 32 (age range: 17–40) for controls. Among cases 51% reported experiencing influenza illness symptoms: fever and cough or fever and sneezing. Detailed immunological analyses of serum and plasma have been conducted. Initial association study between antibody level and risk of experiencing the symptoms upon exposure suggests there may not be significant correlation. Characterization of cellular responses by analyzing the expression of cytokines from peripheral blood mononuclear cells using Elispot, Multiplex and multiparametric flow cytometry assays is in progress. Conclusions Preliminary epidemiological analyses indicate no significant correlation between antibody levels and the risk of experiencing influenza related symptoms. The NorFlu cohort provides a unique opportunity to assess perinatal risks of maternal exposure to influenza virus, as well as to study the interplay of humoral and cellular immunity in pregnancy during the first pandemic of the 21st century. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L56 L E C TU R E A BSTRAC TS SPB7: HOST FACTORS IN PATHOGENESIS SPB701 ALFA Quantitative proteomic analysis of protein signatures in permissive vs. non-permissive influenza A virus infections in human host cells Sadewasser, Anne (1); Paki, Katharina (1); Eichelbaum, Katrin (2); Selbach, Matthias (2); Wolff, Thorsten (1) 1: Div. of Influenza viruses and other Respiratory Viruses; Robert Koch-Institut, Seestr. 10, 13353 Berlin, Germany; 2: Max-Delbrück-Center for Molecular Medicine; Robert-Roessle-Str. 10, 13125 Berlin, Germany Background Influenza virus infections are the major cause for respiratory disease in humans, which affect all age groups and result in extensive global mortality and morbidity, as well as substantial economic costs. Human and most avian influenza A virus (IAV) strains differ largely in their replication efficiency in and activation of human cells despite successful cell entry. We hypothesize that the distinct outcome of an IAV infection with a given virus strain is determined by the differential interplay between specific host and viral factors, which remain to be defined in their entity. Methods By using mass spectrometry-based quantitative proteomics we aim to characterize the sets of cellular and viral factors whose abundance is specifically up- or down- regulated in permissive vs. non-permissive IAV infection, respectively. Our analysis involves a “Spike-in SILAC (stable isotopic labeling by amino acids in cell culture)” approach in human A549 cells that are highly permissive for a seasonal H3N2 IAV strain, but restrict replication of an avian H3N2 virus. This approach allows for the definition and quantitative comparisons of changes in the host cell proteomes in response to infections with these two viruses. Results The analysis resulted in the identification of distinct sets of cellular factors influenced by infections with the human or the avian strain, respectively. Many identified cellular and viral proteins were similarly regulated by both virus strains, but also candidates with distinct changes in permissive vs. non-permissive infection were found. Ongoing studies involve the validation of the detected proteins and bioinformatic and functional analyses to elucidate their roles in IAV infection and their potential contributions to IAV adaptation to human cells. Conclusions In conclusion, we will present initial results of a comprehensive analysis of complex host pathogen interaction networks by using systems biology tools. We expect to identify key parameters related to efficient IAV replication and host specificity and thereby to further our understanding of IAV biology. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L57 L E C TU R E A BSTRAC TS SPB702 ALFA Inhibition of avian and human influenza viruses by human airway mucins Gerlach, Thomas; Matrosovich, Tatyana; Klenk, Hans-Dieter; Matrosovich, Mikhail Philipps University Marburg, Germany Background In humans, influenza viruses replicate in the respiratory epithelium of conducting airways which is covered by the so-called mucous blanket. Mucins, the major components of the blanket, are large multimeric heavily glycosylated sialoglycoproteins. One of their functions is to serve as decoy receptors for carbohydrate-binding bacteria, viruses and toxins. It is generally believed that human airway mucins (HAM) mainly express 3-linked sialic acids and that avian viruses are more sensitive than human viruses to neutralization by HAM (Couceiro et al, 1993). This longstanding concept has been recently challenged by several reports, which revealed high sensitivity of human viruses and low sensitivity of avian viruses to HAM (Roberts and Shelton et al., 2011; Limsuwat et al., 2013). In this study, we wished to address this apparent discrepancy and to clarify the role of HAM in protection of the human airways from influenza infection. Material and Methods Human airway mucins were collected from the apical surfaces of differentiated cultures of human tracheo-bronchial epithelial cells (HTBE) and were used without fractionation. We tested neutralization of representative avian and human influenza viruses by HAM in three different cell systems. MDCK cells were used to reproduce experiments performed in previous studies. MDCK-SIAT1 cells differed from MDCK cells by increased expression of 6-linked sialic acids and decreased expression of 3-linked sialic acids. This pair of cell lines was employed to determine the effects of receptor density on target cells on virus neutralization by mucins. HTBE cultures were used to mimic conditions of influenza virus infection in human airway epithelium in vivo. Neutralization experiments were performed by mixing viruses with serial dilutions of HAM, inoculation of cell monolayers and immunostaining of infected cells for the viral nucleoprotein after one cycle of virus replication. Results In agreement with the recent reports, neutralization experiments in MDCK cells showed that human viruses were more sensitive to HAM than avian viruses. However, human viruses were less sensitive and avian viruses were more sensitive to HAM when MDCK-SIAT cells were used for the assay. In HTBE cultures, avian and human IAVs were neutralized by HAM with comparable efficiency. Conclusions Our results indicate that neutralization of influenza viruses by competitive sialic acid-containing inhibitors strongly depends on the concentration of specific viral receptors on target cells. As a result, neutralization experiments performed in standard laboratory cells, such as MDCK cells, which do not mimic the spectrum of sialic acids in human airway epithelium may lead to erroneous conclusions. Our data on neutralization in differentiated HTBE cultures suggest that during the infection in the human respiratory tract both avian and human influenza viruses can be inhibited by airway mucus. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L58 L E C TU R E A BSTRAC TS SPB703 ALFA The role of endothelial cells in influenza A virus pathogenesis Short, Kirsty Renfree (1); Kasper, Jennifer (2); Fouchier, Ron (1); Kirkpatrick, Charles (2); Kuiken, Thijs (1) 1: Erasmus MC, the Netherlands; 2: Department of Pathology, Medical University of Mainz, Mainz, Germany Background Influenza A virus (IAV) is an important cause of respiratory disease worldwide. The primary cellular target of IAV is epithelial cells within the respiratory tract.Within the lower respiratory tract, alveolar epithelial cells are in close proximity to the underlying endothelium, with only 0.5 μm separating the airspace from the capillary. During IAV infection the endothelium is therefore exposed to free virus particles produced by infected epithelial cells. The role of pulmonary endothelial cells in IAV pathogenesis remains controversial. Numerous in vitro studies have suggested that IAV can infect endothelial cells, trigger apoptosis and facilitate pulmonary oedema. However, there is little if any evidence to suggest that IAV can infect pulmonary endothelial cells in vivo. Instead, studies in mice suggest that endothelial cells produce a large amount of pro-inflammatory cytokines during IAV infection, although these results are yet to be confirmed using human cells. Methods Here, we use an in vitro co-culture model to assess the role of endothelial cells in IAV pathogenesis. are seeded on the upper half of a transwell membrane whilst human endothelial cells are seeded on the lower half. These cells are then grown in co-culture and influenza virus is added to the Briefly, human epithelial cells upper chamber. Unlike conventional in vitro monocultures of endothelial cells, this system allows us to model the dynamic interplay that occurs in vivo between pulmonary epithelial and endothelial cells. Results We show that IAV infection of the epithelium (with viruses of the H1N1, H3N2, H7N9 and H5N1 subtypes) does not result in the infection or death of the underlying endothelial cells, with the epithelium serving to ‘protect’ the endothelium from infection. We further demonstrate that whilst IAV damages pulmonary epithelial cells, this damage occurs independently of the presence of endothelial cells. Instead, we show that endothelial cells drive epithelial cell cytokine production. Specifically, epithelial cells grown in co-culture with endothelial cells produced significantly more pro-inflammatory cytokines than epithelial cells grown in a conventional monoculture. This increased cytokine production was associated with increased expression of RAGE (receptor for advanced glycation endproducts) and its ligand HMGB1 (high mobility group protein B1), suggesting a potential role for RAGE activation in this epithelial-endothelial crosstalk. Conclusions These data provide the first evidence that endothelial cells are not a key target of IAV infection and instead play an essential role in driving cytokine production by epithelial cells during IAV infection. This epithelial-endothelial crosstalk may then have important consequences for the pathogenesis of IAV in vivo. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L59 L E C TU R E A BSTRAC TS SPB704 ALFA Type I interferon receptor 2 (Ifnar2) plays an important role in limiting inflammation and disease following influenza virus infection Tate, Michelle D; Dowling, Jennifer K; Piganis, Rebecca A; Hertzog, Paul J MIMR-PHI Institute of Medical Research, Australia Background The innate immune system provides a critical first line of defence following influenza virus infection, however, excessive inflammation is associated with severe infections in both mice and humans. Type I interferons (IFNs) are an important component of the innate anti-viral response. The type I IFN receptor (Ifnar) is comprised of two chains, Ifnar1 and Ifnar2. Binding of IFNα/β to Ifnar initiates signaling cascades that lead to the upregulation of hundreds of interferon-stimulated genes (ISGs) with immunomodulatory and anti-viral properties. Studies have illustrated that Ifnar1 knockout mice are more susceptible to influenza virus infection than wild-type mice. The role of Ifnar2 during influenza virus infections is currently not known. We hypothesized that Ifnar1 and Ifnar2 may play differing roles in controlling influenza virus infections. Methods To examine the susceptibility of mice lacking components of the type I IFN receptor to influenza virus, wild-type, Ifnar1-/- and Ifnar2-/- mice on a C57BL/6 background were intranasally inoculated with 102 PFU of HKx31 (H3N2). Mice were weighed daily and examined for signs of disease. Viral loads in lung and nasal tissue homogenates were determined by standard plaque assay. Flow cytometry was utilized to examine cellular infiltrate in the airways and cytokines in the bronchoalveolar lavage (BAL) fluid and sera were examined by cytokine bead array and ELISA. The protein concentrations of BAL fluid and lung wet to dry ratios were utilised to examine vascular leakage and edema, respectively. Results Mice lacking Ifnar2 were more susceptible to influenza virus infection than Ifnar1 knockout and wild-type mice. By day 7 post-infection, ifnar2-/- mice displayed evidence of severe disease and had to be euthanised. In comparison to wild-type mice, viral replication was elevated in both the lungs and nasal tissues of Ifnar1 and Ifnar2 knockout mice at days 1, 3 and 7 post- infection, however there were no striking differences between Ifnar1-/- and Ifnar2-/- mice. Severe disease displayed by Ifnar2-/- mice was associated with increased neutrophil infiltration as well as elevated levels of IL-1β in the airways and blood. Furthermore, mice lacking Ifnar2 displayed evidence of edema and vascular leakage. Conclusions Overall, our data suggests the Infar1 and Infar2 chains of the type I IFN receptor play distinct roles in host defence during influenza virus infections. In particular, Ifnar2 appears to play an important role in controlling the production of IL-1β and the induction of severe disease. Understanding further this role of Ifnar2 and how type I IFNs control inappropriate or damaging immune responses will be of great significance to reduce mortality and morbidity associated with influenza. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L60 L E C TU R E A BSTRAC TS PL05: LATE BREAKERS PL0501 OMEGA Post-pandemic Review of anti-Influenza Drug Effectiveness (PRIDE Study): an investigation of the impact of neuraminidase inhibitor antiviral use on pneumonia and length of hospital stay in hospitalized influenza A(H1N1)pdm09 patients Muthuri, Stella; Myles, Puja; Venkatesan, Sudhir; Leonardi-Bee, Jo; Nguyen-Van-Tam, Jonathan Division of Epidemiology and Public Health, University of Nottingham, United Kingdom Background The aim of this study was to investigate the impact of neuraminidase inhibitor (NAI) antiviral treatment on influenza-related pneumonia and length of hospital stay during the 2009-10 A(H1N1)pdm09 influenza pandemic. Methods We conducted an individual patient data meta-analysis of observational data on hospitalised A(H1N1)pdm09 pandemic influenza cases (n=34,910) contributed by 78 research groups from 38 countries within 6 WHO regions. Multilevel logistic regression modelling was conducted separately for the outcomes: influenza–related pneumonia (yes vs no) and length of stay (LOS) in hospital (> 5 days vs ≤ 5days; median LOS= 5 days). We adjusted for propensity scores (based on age, sex, comorbidity and disease severity at admission), treatment with antibiotics and steroids. Results are presented for laboratory confirmed A(H1N1)pdm09 cases of all ages as adjusted odds ratios (aOR) with 95% confidence intervals (CI). Results Analyses for influenza-related pneumonia showed treatment with NAI (at any time) versus no NAI treatment was associated with a significantly increased likelihood of pneumonia (aOR, 1.26 [95% CI, 1.10 – 1.43]). However, we found reduced likelihood of pneumonia when early treatment (≤48h after symptom onset) was compared with later treatment (aOR, 0.51 [95% CI, 0.46 – 0.57]) or no NAI treatment (aOR, 0.83 [95% CI, 0.70 – 0.99]). Compared with no NAI treatment, treatment with NAI (at any time) was significantly associated with longer stay in hospital (aOR, 1.55 [95% CI, 1.40 – 1.71]; early treatment when compared with no treatment was associated with a non-significant increase in hospital stay (aOR, 1.11 [95% CI, 0.95 to 1.29]); whilst early compared with later treatment (aOR, 0.68 [95% CI, 0.62 - 0.75]) showed significant reduction in the duration of hospital stay. Conclusions Early treatment with NAI was associated with a significant reduction in influenza A(H1N1)pdm09 pneumonia compared with either no or later NAI treatment. A significant reduction in the duration of hospital stay was only seen when early NAI treatment was compared with later NAI treatment. Prospero Registration. CRD42011001273. Funding. Unrestricted educational grant from F. Hoffmann-La Roche TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L61 L E C TU R E A BSTRAC TS PL0502 OMEGA Understanding the genome packaging mechanism of influenza viruses Nakatsu, Sumiho (1); Sagara, Hiroshi (2); Noda, Takeshi (1,3); Kawaoka, Yoshihiro (1,4,5) 1: Division of Virology, Department of Microbiology and Immunology, Institute of Medical Science, University of Tokyo, Japan; 2: Medical Proteomics Laboratory, Institute of Medical Science, University of Tokyo, Japan; 3: PRESTO, Japan Science and Technology Agency, Japan; 4: Department of Pathobiological Sciences, School of Veterinary Medicine, University of Wisconsin-Madison, USA; 5: International Research Center for Infectious Diseases, Institute of Medical Science, The University of Tokyo, Japan Introduction Influenza A and B viruses infect humans and cause epidemics. Therefore, both types of influenza virus are considered important pathogens. Although many studies have attempted to elucidate the nature of influenza viruses, their replication mechanisms in host cells remain a mystery. The genomes of influenza A and B viruses possess eight-segmented RNAs. Each viral RNA segment associates with the nucleoproteins and a polymerase, forming a rod-like structure called the ribonucloeprotein (RNP) complex. The lengths of the RNPs vary from 30 to 120 nm depending on the RNA segments. When progeny virions bud from infected cells, they need to package at least one copy of each of the eight different RNPs to be infectious; however, the detailed mechanisms of RNP packaging are not yet fully understood. Previously, our group showed that a laboratory strain of influenza A virus selectively packages eight kinds of RNPs. However, it remains unknown whether influenza B viruses and other influenza A viruses, including clinically isolated strains, employ a similar mechanism. Here, to determine whether the selective packaging mechanism is common to influenza A and B viruses, laboratory and clinical strains of influenza A and B viruses were examined by use of electron microscopy. Material and Methods A/WSN/33 (H1N1) and B/Lee/40 strains were used as laboratory strains; A/Yokosuka/UT-Y291/11 (H1N1) and B/ Yokosuka/UT-Y23/11 were used as clinical strains. The number of RNPs within transversely sectioned virions on ultrathin section was counted manually and compared between each type of virus. The configuration of the RNPs within the virions was examined by using electron tomography. Results & Discussion In transmission electron microscopy (TEM), 8 RNPs were observed within the virions for all of the strains examined, although the percentages of those virions differed for each strain. Electron tomography of the laboratory and clinical strains of influenza A and B virus revealed that most of the virions packaged 8 RNPs, implying that the influenza A and B viruses generally package 8 RNPs. Interestingly, some virions packaged less than 8 RNPs and, therefore, lacked a complete set. These results suggest that a small number of noninfectious particles are also produced, which is consistent with previous reports that some virus-infected cells fail to express all viral proteins (Martin and Helenius, Cell 1991; Brook et al., J Virol 2013). As shown in this study, most virions package 8 RNPs, and strict adherence to this genome packaging mechanism ensures their efficient replication. However, some virions packaged less than 8 RNPs, which are non-infectious. Producing non-infectious viruses would seem to be a disadvantage for the virus; however, that non-robustness in genome incorporation may contribute to the evolution of viruses by allowing easier genome reassortment events when multiple kinds of viruses infect a host in nature. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L62 L E C TU R E A BSTRAC TS PL0503 OMEGA Comparison of aerosol and intra-nasal challenge with 2009 pandemic influenza virus (H1N1) in cynomolgus macaques showed clear differences in the distribution of virus Marriott, Anthony Colin (1), Sally Sharpe (1), Mike Dennis (1), Jennifer Kane (1), Claudia Prevosto (1), Nigel Silman (1), Emma Rayner (1), Simon Bate (1), Saranya Sridhar (2), Karl J. Staples (3), Ajit Lalvani (2), Tom Wilkinson (3), Miles W. Carroll (1) 1: Public Health England, Porton Down, Salisbury SP4 0JG, UK.; 2: Imperial College London, London W2 1PG, UK.; 3: University of Southampton, Southampton SO16 6YD, UK. Background The aim is to develop non-human primate models for upper and lower respiratory tract (URT and LRT) infection with clinically relevant seasonal influenza viruses. Previous studies using H1N1pdm09 virus challenge in macaques have used high doses of virus delivered by the intra-tracheal (IT) route in order to target virus to the LRT, whereas human challenge studies are restricted to URT infection. NHP models have several advantages over human studies including, ability to sample a range of tissues at necropsy (e.g. for pathology), use of more clinically relevant strains, use of aerosol challenge and LRT infection routes, in addition to much reduced set-up time and cost. Methods We have compared the outcomes of challenge by the IT route, the intra-nasal (IN) route, and by small-particle nasally inhaled aerosol. Cynomolgus macaques (male, aged 3-4 years) were challenged with 106 (IT or IN), 105 (aerosol) or 103 (IN) pfu of A/Cal/04/09 virus. Results None of these challenge routes resulted in overt clinical disease (fever, weight loss, respiratory symptoms). However all the animals were infected, as determined by evidence of virus replication, virus shedding and/or seroconversion. IN challenge led to URT infection, with virus replication confined to the nasal cavity. The high IN dose (106 pfu) led to virus shedding on days 3-6 post-infection, but when the dose was reduced to 103 pfu, the infection was nonproductive. Thus the sensitivity of the NHPs to H1N1 virus resembles that seen in human challenge studies, rather than the much more sensitive ferret model. IT and aerosol challenges led to LRT infections. The IT challenge resulted in localized lung infection, whereas the aerosol challenge led to more widespread virus replication in the LRT and URT. Some animals in each group also shed virus in nasal washes. Immune responses in BAL and PBMCs are being analysed for T-cell memory and lung homing markers. The cellular innate immune response in lung mirrored the kinetics of viral replication. Conclusions For the first time, we have demonstrated and directly compared URT and LRT models for H1N1pdm in the macaque, with virus tropism being determined by route of challenge. Furthermore, we showed that a low IN challenge dose (103 pfu) fails to result in productive infection, in contrast to the ferret, which can be productively infected with ≤ 10 pfu influenza virus. These models will be of great value in defining immune correlates of protection and memory responses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L63 L E C TU R E A BSTRAC TS PL0504 OMEGA Secondary Bacterial Pneumonia Suppresses Pulmonary CD8 and CD4 T Cell Responses after Influenza Infection Ghoneim, Hazem E. (1); Smith, Amber M. (1); McCullers, Jonathan A. (1,2) 1: Department of Infectious Diseases, St. Jude Children’s Research Hospital, Memphis, TN, United States of America.; 2: Department of Pediatrics, University of Tennessee Health Science Center, Memphis, TN, United States of America. Background Secondary bacterial pneumonia (SBP) is a major complication during influenza virus infections that leads to increased morbidity and mortality during influenza pandemics epidemics, and seasonal periods. Although several mechanisms underlying this viral-bacterial synergism have been studied, viral-induced alterations in lung microenvironment and antibacterial immunity that enhances the susceptibility to SBP are most studied. However, the effect of the subsequent bacterial infections on the host adaptive immune responses against primary influenza infections is unclear. Methods To initiate SBP, we intranasally infected BALB/c mice with a sublethal dose of influenza virus PR8 followed by a sublethal dose of Streptococcus pneumoniae (pneumococcus) using serotypes 3 and 2 strains A66.1 and D39, respectively. We analyzed the number and function of total CD8 and CD4 T cells in the alveolar airspaces, lung tissues and mediastinal lymph nodes at different timepoints after single influenza infection or secondary pneumococcal challenge. We also analyzed pulmonary PR8-specific CD8 T cell numbers and viral titers in single influenza infected and co-infected mice. Results The absolute number of CD8 T cells, CD4 T cells and influenza-specific CD8 T cells are significantly decreased in the lungs and alveolar airspaces of co-infected mice compared to those with single influenza infection, which is correlated with successful development of SBP in co-infected mice. Furthermore, the ability of these cells to produce IFN γ intracellularly is significantly decreased after ex vivo stimulation. Progression into SBP is associated with a significant increase in influenza viral titers and delayed viral clearance. Conclusions We identified a novel immunosuppression mechanism during co-infection such that SBP suppresses CD8 and CD4 T cell responses against the ongoing influenza virus replication. This immunosuppression is associated with significant increase in influenza viral titers and delayed viral clearance, which may complicate the severity of SBP. Our current and previous findings suggest a bidirectional interaction between primary influenza and secondary bacterial infections. That is, primary influenza infection can suppress host protective antibacterial immunity in the lungs leading to SBP while secondary bacterial infections may also suppress the virus-specific adaptive immunity. Our findings may highlight the importance of combining anti-viral with anti-bacterial therapeutic approaches to treat co-infected hosts. Furthermore, this defect in effector T cell immunity might have negative outcomes on the development of memory T cell responses as well. Therefore, it is crucial to determine the impact of this early immunosuppression on the development of effector and central memory T cells against influenza infections. Further exploration of this immunosuppression mechanism and its outcomes might result in novel therapeutic approaches for lung coinfections. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L64 L E C TU R E A BSTRAC TS PL0505 OMEGA Pathogenicity of airborne-transmissible H5N1 viruses. Mathilde Richard, Sander Herfst, Judith van den Brand, Pascal Lexmond, Theo Bestebroer, Ab Osterhaus, Thijs Kuiken and Ron Fouchier Department of Viroscience. ErasmusMC. Rotterdam. Netherlands. Background Since 2003 H5N1 viruses have been continuously circulating in poultry in Eurasia, occasionally spilling over to wild birds and mammals, including humans. This circulation has led to an ongoing evolution of the H5N1 viruses in poultry. As a consequence, it is feared that H5N1 viruses with pandemic potential, i.e. with the ability to transmit via the air between humans, might emerge. Herfst et al. demonstrated that H5N1 virus could indeed acquire substitutions conferring airborne transmissibility between ferrets. Five to nine mutations of these substitutions were found to be of particular importance for airborne transmissibility: PB2 E627K, PB1 H99Y, PB1 I368V, NP R99K, NP S345N, HA Q222L, HA G224S, HA T156A and HA H103Y. Now that light has been shed on the determinants necessary for avian influenza viruses to become transmissible via the air, new studies are crucial in order to understand, in depth, the impact of such findings for public health. There are no studies to date characterizing the pathogenicity of fully avian-origin airborne-transmissible influenza viruses in mammals nor in poultry, such as chickens. Such studies are of importance in order to address the chances of airborne-transmissible H5N1 emerging in chickens, and the impact that this may have on human health. Methods Reverse genetics techniques were used to design H5N1 viruses with all or subsets of airborne mutations. We inoculated ferrets and chickens with airborne-transmissible H5N1 viruses and wild-type H5N1 virus. Respiratory samples were collected daily to assess viral shedding. Detailed necropsies followed by pathological examination were performed at fixed time points to analyze the pathogenicity, replicative capacity and tissue tropism of airbornetransmissible H5N1 viruses in comparison with wild-type H5N1 virus. Results Airborne-transmissible H5N1 viruses were attenuated, both in terms of mortality and morbidity, in ferrets and in chickens. The contribution of different substitutions or combinations of substitutions to the attenuation and phenotype of the airborne-transmissible H5N1 viruses is currently under investigation. Conclusion Here, we provide the first in depth characterization of the pathogenicity of airborne-transmissible H5N1 viruses in both ferrets and chickens. The findings of these studies emphasize the need to study airborne-transmissible H5N1 viruses as they help to assess both the likelihood of these viruses emerging in poultry and the consequences that these viruses may have for human morbidity and mortality. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA L65 POSTE R A BSTRAC TS P OSTER A B STR ACTS TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P1 POSTE R A BSTRAC TS SPA1: CLINICAL IMPACT AND DIAGNOSTIC APPROACHES SPA1P01 Clinical usefulness of the BD Veritor System for Rapid Detection of Flu A+B to detect influenza viruses Noh, Ji Yun (1); Choi, Won Suk (1); Lee, Jacob (2); Seo, Yu Bin (2); Lee, Jung Hwa (3); Song, Joon Young (1); Cheong, Hee Jin (1); Kim, Woo Joo (1,4) 1: Division of Infectious Diseases, Department of Internal Medicine, Korea University College of Medicine, Seoul, Korea, Republic of (South Korea); 2: Division of Infectious Diseases, Department of Internal Medicine, Kangnam Sacred Heart Hospital, Hallym University School of Medicine, Seoul, Korea, Republic of (South Korea); 3: Department of Pediatrics, Korea University College of Medicine, Seoul, Korea, Republic of (South Korea); 4: Transgovernmental Enterprise for Pandemic Influenza in Korea, Seoul, Korea, Republic of (South Korea) Background Rapid antigen test has been used widely for prompt diagnosis of influenza. The aim of this study is to evaluate the clinical usefulness of the BD VeritorTM System for Rapid Detection of Flu A+B in patients with influenza-like illness (ILI). Methods Respiratory specimen was obtained from 434 patients with ILI in three teaching hospitals, South Korea during 20132014 influenza season. The performance of the BD VeritorTM System for Rapid Detection of Flu A+B was compared with the results of SD Bioline Influenza Ag and the Humasis Influenza A/B antigen Test. Results The number of patients who participated in the study was 434. Median age of the adult patients (≥15 years) was 37 years (IQR 30-53) and that of children was 4 years (IQR 2-7). The median time to sample collection from symptom onset was 2 days (IQR 1-3) in adults. Among 434 specimens, 210 (48.4%) were positive for influenza A virus and 56 (11.6%) were influenza B viruses. To detect overall influenza viruses, the BD VeritorTM System for Rapid Detection of Flu A+B showed 80.8% sensitivity, 88.5% specificity, 91.7% positive predictive value, and 74.6% negative predictive value in adult patients, and 93.3% sensitivity, 83.9% specificity, 89.4% positive predictive value, and 89.7% negative predictive value in children. For influenza A virus, BD VeritorTM System for Rapid Detection of Flu A+B yielded higher sensitivity than the SD Bioline Influenza Ag and the Humasis Influenza A/B antigen Test in adults: 81.5%, 60.1%, and 43.8%, respectively. For influenza B virus, BD VeritorTM System for Rapid Detection of Flu A+B showed 71.4% sensitivity, while sensitivities of the SD Bioline Influenza Ag and the Humasis Influenza A/B antigen Test were 83.3% and 42.9% in adults. In children, the BD VeritorTM System for Rapid Detection of Flu A+B showed 93.8% sensitivity in detection of influenza A viruses, and the sensitivities of the SD Bioline Influenza Ag and the Humasis Influenza A/B antigen Test were 81.3% and 53.1% for influenza A viruses. Conclusions The BD VeritorTM System for Rapid Detection of Flu A+B showed a good sensitivity to detect influenza viruses. It would be useful for early diagnosis of influenza. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P2 POSTE R A BSTRAC TS SPA1P02 Diagnosis of human influenza A virus infection using single chain fragment variable antibody-based competitive inhibition ELISA Rajput, Roopali (1); Sharma, Gaurav (2); Saxena, Latika (1); Khanna, Madhu (1); Pradhan, Hare Krishna (3); Pattnaik, B. (2) 1: Dept. of Respiratory Virology, Vallabhbhai Patel Chest Institute, University of Delhi, Delhi-110007, India; 2: Project Directorate on Foot and Mouth Disease, Mukteswar, Nainital-263138, India; 3: Former National Consultant (Avian Influenza), WHO-India office, Delhi-110001, India Background Influenza A viruses pose a major concern for public health and are responsible for significant morbidity and mortality not only in humans but also in the other host species. Precise diagnosis of influenza A virus infection is critical for the treatment of the viral infection and prevent frequent occurrence of the viral outbreaks. Thus, efficient sero-diagnostic strategies are required for assessment of pre-existing and/ or cross-protective immunity among human population to devise better preparedness plans. The relative ease of large-scale production and high specific reactivity led us to develop recombinant single chain variable fragment (scFv) antibodies against the NP and NS1 proteins of pandemic influenza H1N1 (2009) virus for development of an ELISA-based sero-diagnostic test, which efficiently differentiated among the vaccinated and influenza A virus infected individuals. Methods The scFv antibodies were developed from spleen cells of the mice, hyper- immunized with pandemic influenza H1N1 (2009) virus. The antibody genes were amplified from the isolated mRNA and cloned in pSEX81 phagemid vector for generation of phage display antibody library against the viral proteins. The NS1- or NP- specific scFv-displaying phages were selected, from the library, by bio-panning against the respective antigens. The recombinant phage clones, showing high yield in antigen-binding phage ELISA, were used for production and purification of functional scFv antibodies in bacterial cells, by transfer of the scFv cassette from the positive phagemid clones into the plasmid vector. The antibodies were purified and analyzed for their antigen binding efficacy. The phage displayed antibodies were used for development of enzyme linked immunosorbent assay in a competitive inhibition format for its higher sensitivity and specificity over the indirect ELISA (Bhatia et al., 2008). Results The reactivity of soluble scFv antibodies was higher in antigen capture ELISA than the antigen tracing format. Of the total 50 samples, 28 samples were from patients, who acquired natural infection of influenza A (H1N1) virus, 12 from individuals vaccinated against influenza virus and 10 served healthy controls. Anti- NS1 antibodies were detected only in the influenza virus infected patients, except 6 H3N2 samples, whereas anti- NP antibodies were found in both virus infected and vaccinated samples. Conclusions Our findings suggest that the recombinant anti-NS1 and anti-NP scFv antibodies developed in this study prove to be significant for sero-diagnosis of human influenza A virus infection and epitope mapping of the antigens. The test may be used for evaluation of pre-existing immunity against various strains/ sub-types of influenza A virus. It may also help in assessment of vaccine efficacy, as the dual-parameter test can differentiate between the infected and non-infected individuals. The test may also be exploited as a cheaper alternative to the presently used real time RTPCR diagnostic assay, in developing nations like India. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P3 POSTE R A BSTRAC TS SPA1P03 Hospitalizations with influenza in the northern hemisphere 20132014 influenza season. Results from the Global Influenza Hospital Surveillance Network Puig-Barberà, Joan (1); Tormos, Anita Marie Catherine (1); Sominina, Anna (2); Ciblak, Meral (3); Mira-Iglesias, Ainara (1); Natividad-Sancho, Angels (1); Buigues-Vila, Amparo (1); Burtseva, Elena (4) 1: FISABIO-Salud Pública, Spain; 2: Research Institute of Influenza, St. Petersburg, Russian Federation; 3: National Influenza Reference Laboratory Capa-Istanbul, Istanbul, Turkey; 4: D.I. Ivanovsky Institute of Virology, Moscow, Russian Federation The GIHSN (Global Influenza Hospital Surveillance Network) Group members: F Aktaş, Faculty of Medicine, Gazi University, Ankara, Turkey; S Badur, Istanbul Faculty of Medicine, Istanbul, Turkey; A Buigues Vila, FISABIO-Salud Pública, Valencia, Spain; S Borekci, Cerrahpaşa Faculty of Medicine, Istanbul University, Istanbul, Turkey; M Carballido, Hospital General, Castellón, Spain; C Carratalá Munuera, Universidad Miguel Hernández, San Juan de Alicante, Spain; M Ciblak, National Influenza Reference Laboratory Capa-Istanbul, Istanbul, Turkey; S Çelebi, Uludağ University Faculty of Medicine, Bursa, Turkey; Denef B. Deniz, Dr. Siyami Ersek Göğüs Kalp ve Damar Cerrahisi Eğitim ve Araştırma Hastanesi Istanbul, Turkey; M Durusu, Hacettepe Üniversitesi, Ankara, Turkey; C El Guerche-Seblain, Sanofi-Pasteur, Lyon, France; S Gencer, Dr. Lütfi Kırdar Kartal Training andResearch Hospital, Istanbul, Turkey ; V Gil Guillén, Universidad Miguel Hernández, San Juan de Alicante, Spain; M Hacımustafaoğlu, Uludağ University, Bursa, Turkey; Selda Hancerli, Istanbul Faculty of Medicine, Istanbul University, Istanbul, Turkey; L Kolobukhina, D.I Ivanovsky Institute of Virology, Moscow, Russian Federation; R Limón Ramírez, Hospital La Plana, Vila-real, Spain; C Mahé, Sanofi-Pasteur, Lyon, France; A Mira Iglesias, FISABIO-Salud Pública, Valencia, Spain; J Mollar Maseres, Hospital La Fe, Valencia, Spain; A Natividad Sancho, FISABIO-Salud Pública, Valencia, Spain; L Ozisik, Hacettepe University, Ankara, Turkey; L Osidak, Research Institute of Influenza, North-West Department of Russian Academy of Medical Sciences, St. Petersburg, Russian Federation; MC Otero Reigada, Hospital La Fe, Valencia, Spain; S Özer, Dr. Lütfi Kırdar Kartal Training and Research Hospital, Istanbul, Turkey; M Pisareva, Research Institute of Influenza; St.Petersburg Russian Federation; J Puig-Barberà, FISABIO-Salud Pública, Valencia, Spain; A Eren Şensoy, Dr. Siyami Ersek Göğüs Kalp ve Damar Cerrahisi Eğitim ve Araştırma Hastanesi, Istanbul, Turkey; S Şimşek Yavuz, Dr. Siyami Ersek Göğüs Kalp ve Damar Cerrahisi Eğitim ve Araştırma Hastanesi, Istanbul, Turkey; Solmaz Çelebi, Uludağ University Faculty of Medicine, Bursa, Turkey; A Sominina, Research Institute of Influenza; St. Petersburg, Russian Federation; K Stolyarov, Research Institute of Influenza, St. Petersburg, Russian Federation; A Tormos, FISABIOSalud Pública, Valencia, Spain; M Tortajada Girbés, Hospital Dr Peset,Valencia, Spain; S Trushakova, D.I Ivanovsky Institute of Virology, Moscow, Russian Federation. Background The Global Influenza Hospital Surveillance Network (GIHSN) was launched in 2012 to address growing awareness that influenza-related hospitalization is a significant burden that remains insufficiently characterised. The GIHSN is a partnership between industry and public health institutions that use active surveillance and a common core protocol to collect data on the epidemiology of severe influenza. We here present the preliminary results for the 2013-2014 northern hemisphere influenza season. Methods During the main influenza season of 2013-2014, the GIHSN included 17 hospitals from the northern hemisphere, 6 in Spain, 7 in Turkey and 4 in the Russian Federation. Hospitalized patients of all ages presenting influenza like-illness (ILI) within 7 days between the onset of symptoms and admission were swabbed. Positives for influenza were real time reverse transcription polymerase chain reaction (RT-PCR) positive for influenza A(H3N2), A(H1N1)pdm09, or B. Results Of the 6,887 patients screened, 4,217 were eligible and tested, 784 (19%) were positive for influenza and 3,272 (81%) negative. A(H3N2) was dominant (n=390, 50%), followed by A(H1N1)pdm09 (n=334, 43%). Few cases of influenza B were observed (n=32, 4%). A(H3N2) was most common in Turkey, St. Petersburg and Moscow in ages between 18 and 50 years old, and caused a mean length of stay at the hospital of 6.08 days [95% CI: 5.74 – 6.42]. For the GIHSN sites of the northern hemisphere, the influenza season started beginning of December with a peak of A(H1N1)pdm09 from week 3 to week 5, and a second peak of A(H3N2) from week 8 to week 10. Socio-demographic characteristics such as age, having a chronic conditions (OR 1.34; 95%CI: 1.14– 1.57), smoking habits (OR 1.23; 95%CI: 1.03–1.47) and being pregnant (OR 3.17; 95%CI: 2.12–4.74) were significantly different between positives and negatives with p-values of <0.05. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P4 POSTE R A BSTRAC TS Conclusions A(H3N2) was highly circulating in the younger in east and south-eastern Europe, and A(H1N1)pdm09 was present mostly in the elderly in south-western Europe. There was a peak at a later appearance for A(H3N2) compared to A(H1N1)pdm09. The data from this network provides information for influenza epidemiology giving a global overview of the Influenza season 2013-2014 in the northern hemisphere. Funding: This network activity is partly funded by Sanofi Pasteur. Number of positives for influenza by epidemiological week GIHSN Spain 60 50 40 30 20 10 0 40 30 20 N=68 10 20 13 20 -50 13 20 -51 13 20 -52 14 20 -01 14 20 -02 14 20 -03 14 20 -04 14 20 -05 14 20 -06 14 20 -07 14 20 -08 14 20 -09 14 20 -10 14 20 -11 14 20 -12 14 20 -13 14 20 -14 14 -1 5 13 -5 0 13 -5 1 13 20 52 14 -0 20 1 14 20 02 14 -0 20 3 14 20 04 14 -0 20 5 14 20 06 14 -0 20 7 14 -0 20 8 14 -0 20 9 14 -1 20 0 14 -1 20 1 14 -1 20 2 14 20 13 14 -1 20 4 14 -1 5 20 Epidemiologcial Week at Admisison >=50 - <65 yrs >=65 - <75 yrs Epidemiological Week at Admission Moscow, Russia Number of positives for influenza 50 40 30 20 10 60 N=248 N=108 50 >=75 - <85 yrs 40 N=77 >=85 yrs 30 20 10 Turkey 70 60 20 20 13 -5 0 13 -5 1 13 -5 20 2 14 -0 20 1 14 -0 20 2 14 20 03 14 20 04 14 -0 20 5 14 20 06 14 20 07 14 -0 20 8 14 20 09 14 20 10 14 -1 20 1 14 -1 20 2 14 -1 20 3 14 20 14 14 -1 5 20 20 Epidemiological Week at Admission 13 -5 0 13 -5 1 13 -5 20 2 14 -0 20 1 14 -0 20 2 14 -0 20 3 14 -0 20 4 14 -0 20 5 14 -0 20 6 14 -0 20 7 14 -0 20 8 14 -0 20 9 14 -1 20 0 14 -1 20 1 14 -1 20 2 14 -1 20 3 14 -1 20 4 14 -1 5 0 0 20 Number of positives for influenza N=63 N=103 >=18 - <50 yrs 70 60 20 >=5 - <18 yrs 50 St. Petersburg, Russia 70 N=88 N=28 Epidemiological Week at Admission H1N1 H3N2 A-Not subtyped Yamagata Victoria B-Not subtyped 50 Virus distribution for hospitalized patients by age group in years 40 30 20 10 20 20 13 -5 0 13 -5 1 13 20 52 14 -0 20 1 14 -0 20 2 14 20 03 14 -0 20 4 14 20 05 14 -0 20 6 14 20 07 14 -0 20 8 14 -0 20 9 14 20 10 14 -1 20 1 14 -1 20 2 14 -1 20 3 14 -1 20 4 14 -1 5 0 20 Number of positives for influenza >=1 - <5 yrs 60 0 20 20 >=0 - <1 yrs 70 Num ber of positives for influenza Number of positives for influenza 70 Epidemiological Week at Admission TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P5 POSTE R A BSTRAC TS SPA1P04 Influenza in pregnant women during 2012-2014, Moscow, Russia Trushakova, Svetlana (1); Kisteneva, Lidiya (1,2); Kruzhkova, Irina (2); Mukasheva, Evgeniya (1); Krasnoslobodtsev, Kirill (1); Siluyanova, Elina (1); Garina, Ekaterina (1); Kolobukhina, Ludmila (1,2); Burtseva, Elena (1) 1: D.I.Ivanovsky Research Institute of Virology, Russian Federation; 2: Hospital #1 for Infectious Deseases, Moscow, Russian Federation Background Pregnant women are one of the main groups at risk for influenza infection and subsequent complications. Results of influenza monitoring in hospitalized pregnant women in 2012-2014 are presented. Methods Pregnant women with influenza like-illness (ILI) were admitted to Hospital #1 for infectious diseases in Moscow. Patients were interviewed based on the Global Influenza Hospital Surveillance Network (GIHSN) protocol. Reliable patients having ILI within 7 days between the onset of symptoms and admission were swabbed. RT-PCR was applied to detect influenza A(H3N2), A(H1N1)pdm09 and B viruses. Results Since December 2012 to March 2014 2050 hospitalized patients were tested for influenza infection. Among them there were 738 pregnant women aged 15-40: in the season 2012-2013 – 523 women, in 2013-March 2014 – 215 women. The number of influenza positive cases in pregnants was 48% in the season 2012-2013 (A(H1N1)pdm09 – 29%; A(H3N2) – 9%; B – 10%) and 44% in the season 2013-2014 (A(H1N1)pdm09 – 5%; A(H3N2) – 36%; B – 3%). The onset of the disease was acute with such symptoms as high fever, malaise, headache and sore throat. The most common underlying medical conditions among pregnants were renal impairment, cardiovascular and chronic obstructive pulmonary disease. According to the season 2012-2013 most of admitted women were in the second (36%) and third (37%) trimesters of pregnancy. Threatening miscarriages were registered in 41% of pregnants, miscarriages - in 5% of them. In obstetric ward 18 childbirths happened in women with confirmed influenza. Complications like as urinary tract infections, bronchitis and sinusitis were registered in 27% of pregnants, pneumonia – in 3,6% of them. Smoking while pregnant was reported in 5,5% of women. No one of pregnants was vaccinated in the studied period, but 18-20% of them were vaccinated in the previous seasons. To detect overall influenza viruses, the BD VeritorTM System for Rapid Detection of Flu A+B showed 80.8% sensitivity, 88.5% specificity, 91.7% positive predictive value, and 74.6% negative predictive value in adult patients, and 93.3% sensitivity, 83.9% specificity, 89.4% positive predictive value, and 89.7% negative predictive value in children. For influenza A virus, BD VeritorTM System for Rapid Detection of Flu A+B yielded higher sensitivity than the SD Bioline Influenza Ag and the Humasis Influenza A/B antigen Test in adults: 81.5%, 60.1%, and 43.8%, respectively. For influenza B virus, BD VeritorTM System for Rapid Detection of Flu A+B showed 71.4% sensitivity, while sensitivities of the SD Bioline Influenza Ag and the Humasis Influenza A/B antigen Test were 83.3% and 42.9% in adults. In children, the BD VeritorTM System for Rapid Detection of Flu A+B showed 93.8% sensitivity in detection of influenza A viruses, and the sensitivities of the SD Bioline Influenza Ag and the Humasis Influenza A/B antigen Test were 81.3% and 53.1% for influenza A viruses. Conclusions The results showed the involvement of pregnant women in epidemic process was high independently of etiology of influenza epidemics. At the same time the morbidity among pregnants corresponded to the etiology of influenza epidemics in 2012-2014: the predominant types of influenza were A(H1N1)pdm09 in the 2012-2013 season and TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P6 POSTE R A BSTRAC TS A(H3N2) – in the 2013- 2014 season. Influenza is able to induce different complication including threatening miscarriage. Therefore vaccination, rapid hospitalization and early antiviral therapy are the main way to prevent and protect against influenza among high risk population groups. This work is partly funded by Sanofi Pasteur. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P7 POSTE R A BSTRAC TS SPA1P05 Laboratory monitoring of influenza like illnesses (ILI) and severe acute respiratory infections (SARI) in the flu sentinel surveillance system in the Republic of Kazakhstan during last three seasons – 2011-2014 Aushakhmetova, Zabira T.; Kiyanbekova, Lyazzat S.; Abeev, Arman B.; Demesinova., Balzira M.; Kasenova, Zhulduz K. Center of Sanitary Epidemiological Expertise of the Agency of Consumers’ Rights Protection of Kazakhstan Republic, Kazakhstan Background The Republic of Kazakhstan (RK) implemented influenza sentinel surveillance in 2008, with currently seven sites conducting among influenza-like illness (ILI) and severe acute respiratory illness (SARI) surveillance in seven different geographical areas – mostly on the bordering countries and in the capital of RK with active migration of the population. Improvement of laboratory diagnosis is necessary to understand the epidemiology of cases, manage cases, and understand the economic consequences of annual flu epidemics. Methods There were 1739 ILI patients and 2747 SARI patients investigated during the last three influenza seasons – 20112014. Nasal and pharyngeal specimens were collected from patients during the first three days from onset of clinical symptoms meeting the standard definitions of ILI and SARI. The samples were tested using real time RT-PCR according to the CDC protocol. Zonal virology laboratories (ZVL) used the lyophilized panel prepared by “Vector Best” company (Russia, Novosibirsk) with different type and subtypes of the viruses in different concentrations, including H5N1, for an external control quality program (ECQP) for the seven sentinel laboratories. One ZVL is regularly doing retesting of the all positives and 10% of negatives from the six other sentinel sites using CDC/Atlanta primers for ECQP. Results Influenza-positive results among patients with ILI increased from 16% (n=553) in the season of 2011-2012 to 27% (n=517) in the last season of 2013-2014. Influenza-positive results among SARI patients increased from 22% (n=814 SARI patients in the 2011-2012 season) to 30% (n=879) during the season 2013/2014. During all three seasons, flu virus of A type was identified in both of ILI and SARI patients in 83% cases, and flu virus of B type in 17% cases. Subtypes of flu virus of A type varied during all three seasons and in different areas. There was active circulation of both subtypes of Influenza A – H3N2 and H1N1-09-- in west/south of RK, in the east and in the capital of RK during 2013-2014 season. Predominant subtype in the north/west was H1N1-09 – 88% (42/48); predominant virus H3N2 was in the far north 92% (35/38) and in the south - 75% (15/20). We tried to analyze from where the flu virus comes to the RK. Among the seven sites, two cities with active migration first identified flu virus during last three seasons as did one city in the south which has a border with Kyrgyzstan, Uzbekistan and China. Due to the ECQP program, the retesting results from 6 laboratories improved from 90% to 98% during last three seasons. Conclusions Laboratory monitoring of circulating types and subtypes of flu viruses is permitting us to understand the importance of influenza and its epidemiology in Kazakhstan. The ECQP helped to improve laboratory capacity in all sentinel surveillance laboratories. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P8 POSTE R A BSTRAC TS SPA1P06 COMPARATIVE ANALYSIS OF mariPOC SYSTEM AND rRT-PCR IN DETECTION OF INFLUENZA A VIRUS IN CLINICAL SAMPLES Petrova, Ekateria; Krivitskaya, Vera; Pisareva, Maria; Buzitskaya, Zhanna; Sukhovetskaya, Vera; Danilenko, Daria; Suddenkova, Polina; Sominina, Anna A. Research Institute of Influenza, Russian Federation Background This study aimed to compare PCR with new automated rapid diagnostic mariPOC system (ArcDia International Oy Ltd, Finland). Methods The mariPOC system is based on the principle of two-photon excitation of fluorescence and applying of drychemistry reagents. Assay scheme includes: polymer microspheres coated by antibodies and fluorescently labeled antibody conjugate. Fluorescent immunocomplexes are formed on the microsphere’s surface (Janne O. Koskinen et al., J. Clin. Microbiol. – 2007. – Vol.45, No11. – p. 3581–3588). Sample buffer was added to nasopharyngeal swabs and specimens were vortexed to disrupt the mucus before the analysis. Results Nasal swabs from 116 children (aged 9 days to 14 years) were investigated for presence of influenza A antigens using both PCR and mariPOC in parallel. mariPOC system was the most efficient in detection of influenza A virus (IAV) in samples with RNA content up to 25 cycles of amplification in PCR. Sixteen of investigated samples appeared to be positive in PCR and 15 of them were positive in mariPOC. The sensitivity and the specificity in IAV detection using mariPOC in comparison with PCR was 93,8% and 99,0% respectively. Total results coincidence was registered in 98,3% of cases. Negative and positive predictive values for detecting IAV were 93,8% and 99% respectively. Fourteen specimens were analyzed for presence of IAV by isolation in MDCK cell culture. Eleven of them were positive in PCR. Six samples were positive for IAV by culture. All of the samples positive by culture were positive in mariPOC as well. Also 2 clinical samples which were negative by virus isolation but positive in PCR, IAV was detected by mariPOC. Thus, detection of influenza A virus by the mariPOC system showed a higher sensitivity than the virus isolation method. Conclusions Comparative investigation showed mariPOC as highly effective system in detection of influenza A virus. Simplicity of analysis and rapid results are the great advantages of mariPOC in diagnosis of influenza A in clinical conditions. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P9 POSTE R A BSTRAC TS SPA1P07 Seizure following respiratory viral infection versus immunization in infants and children – a syndromic surveillance study Grover, Sandeep (1); Weick, Anja (1); Obermeier, Patrick (1); Chen, Xi (1); Seeber, Lea (1); Tief, Franziska (1); Karsch, Katharina (1); Muehlhans, Susann (1); Hoppe, Christian (1); Adamou, Eleni (1,2); Behrens, Stephanie (1); Reiche, Janine (2); Schweiger, Brunhilde (2); Rath, Barbara (1) 1: Department of Pediatrics, Division of Pneumonology-Immunology, Charité University Medical Center Berlin, Germany; 2: National Reference Centre for Influenza, Robert Koch Institute, Berlin, Germany Background Pediatric seizures cause significant disease burden and distress to patients, parents and caregivers. Febrile seizures in children are commonly triggered by acute respiratory infections. Complicated febrile seizures and afebrile seizures may be early indicators of future motor manifestations. In rare instances, seizures may also represent adverse events following immunization (AEFI). Syndromic hospital-based surveillance data of seizures following recent infection versus immunization in infants and children are currently lacking. Methods This inception cohort study was conducted in the context of a quality management (QM) program for children with influenza-like illness (ILI) at the Charité Department of Pediatrics in collaboration with the National Reference Centre for Influenza at the Robert Koch Institute (Charité Influenza-Like Disease = ChILD Cohort). All pediatric patients (aged 0-18) fulfilling pre- defined ILI case criteria and presenting to the emergency room and inpatient units were enrolled consecutively from 10/2009 through 11/2013. A specifically trained QM team performed highly standardized clinical assessments in real-time. Seizure cases were ascertained in compliance with the Brighton Collaboration AEFI definition. Nasopharyngeal swabs were collected for blinded real-time PCR testing for influenza A&B virus, RSV, human metapneumovirus, human rhinovirus and adenovirus at the Robert Koch Institute. Multivariate analysis correlating seizures to multiple clinical, laboratory and demographic variables was conducted using binary logistic regression analysis. Results A total of 4158 ILI cases were included, with 414 patients fulfilling seizure criteria. More than 80% of seizure cases were identified in children below three years of age. Among the respiratory viruses tested, multivariate analysis identified a significant association of seizure with influenza A (H3N2) and adenovirus infections (OR=1.80, 95% CI=1.06-3.11, p=0.031; OR=1.46, 95% CI=1.1-2.17, p=0.046). With respect to clinical risk factors, underlying hepatorenal conditions were strongly associated with a likelihood to develop seizures in the context of ILI (OR=2.41, 95% CI=1.64-3.54, p<0.0001). Multivariate analysis did not identify a significant association between seizure and immunization per se. However, when analyzing the likelihood to develop seizure depending on the time elapsed since the most recent routine childhood immunization, immunization against mumps, measles, rubella and/or varicella were all significantly associated with seizure in the context of ILI (p<0.0001). Conclusions Influenza A (H3N2) and adenoviral infections, as well as underlying hepato-renal conditions may all increase the likelihood for children to develop seizures in the context of ILI. Higher influenza vaccination may therefore decrease the risk of seizures. Interestingly, recent immunization with mumps, measles, rubella and/or varicella vaccines further increases the likelihood of seizure in the context of ILI. This study underlines the importance of timely diagnostics and accurate immunization histories in the pediatric acute care and inpatient settings. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P10 POSTE R A BSTRAC TS SPA1P08 Importance of Influenza infection in the etiology of exacerbations of COPD during a singular pandemic and post-pandemic period Sanz, Iván (1,2); Tamames, Sonia (1,3); Rojo, Silvia (1,2); Justel, Mar (2); Vega, Tomás (3); Ortiz de Lejarazu, Raúl (1,2) 1: Valladolid National Influenza Center, Spain; 2: Microbiology & Immunology Service - Hospital Clinico Universitario de Valladolid, Spain; 3: Conserjería de Sanidad - Junta de Castilla y León, Spain Background Influenza and other respiratory virus infections are a known cause of acute exacerbations of COPD (AE-COPD). Emergence of a new pandemic influenza virus in 2009 A/H1N1pdm09 has generated the opportunity to evaluate the burden of this clinical event. The aim of this work was to study viral etiology of AE-COPD during pandemic emergence of new influenza virus and following post-pandemic periods. Methods An observational retrospective study was conducted selecting 239 respiratory samples from AE-COPD patients between 2009 pandemic (May 2009 – May 2010) and Post-pandemic (June 2010 – January 2013). Patients were recruited from Hospitals and Influenza Surveillance Sentinel Network of Castilla y León (ISSN) (Spain) for viral diagnostic following previously established clinical criteria. Clinical information was extracted from clinical petitions. Microbiology diagnostic was done by means of a set of RT-PCR multiplex molecular techniques for the detection of 21 viruses in Valladolid National Influenza Centre and Microbiology and Immunology Service of Hospital Clinico Universitario de Valladolid. Results During pandemic period (May 2009 – May 2010) Influenza A/H1N1pdm09 virus was the main virus affecting AECOPD patients (34.4%). However, in the following post-pandemic periods viral etiology of AE-COPD changed. In the first inter epidemic period (June 2010 - September 2010) RSV was the most prevalent virus (16.7%). In the first epidemic season after pandemic (October 2010 – May 2011), RSV and Influenza A/H1N1pdm09 were the viruses most prevalent (16.7% each one), and in second inter epidemic season (June 2011 – September 2011) any virus was the main responsible of AE-COPD. In the last Influenza epidemic season analyzed (October 2011 – May 2012) the main virus affecting COPD patients was A/H3 Influenza virus, and any case A/H1N1pdm09 virus wasn ́t detected in this period. During the last inter epidemic period analyzed (June 2012 – January 2013) it wasn ́t detected any Influenza virus affecting COPD patients (Table1). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P11 POSTE R A BSTRAC TS Table 1. Evolution of mean age, percentage of males and main respiratory viruses affecting AE- COPD patients during pandemic and post-pandemic periods. Table 1. Evolution of mean age, percentage of males and main respiratory viruses affecting AECOPD patients during pandemic and post-pandemic periods. Conclusions Viral etiology in patients with AE-COPD has changed from pandemic to subsequent post-pandemic flu seasons. Conclusions. Influenza A/H1N1pdm09 virus was the most prevalent during pandemic, but patterns changed in post-pandemic, Viral etiology in patients with AE-COPD has changed from pandemic to subsequent post-pandemic flu seasons. Influenza A/H1N1pdm09 the most prevalent during being RSV and A/H3 Influenza virusvirus thewasmain etiological agents causing AE-COPD. Mean age of patients raised pandemic, but patterns changed in post-pandemic, being RSV and A/H3 Influenza virus the during all period Proportion malesraised hadduring beenallincreasing since the beginning of the -study, being men the main etiological agents studied. causing AE-COPD. Mean age of of patients period studied. Proportion of males had been increasing since the beginning of the -study, being men majority of viral etiology cases at the end of studied period. the majority of viral etiology cases at the end of studied period. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P12 POSTE R A BSTRAC TS SPA1P09 Influenza A and B burden in Latin American countries Ferro Bricks, Lucia (1); Falleiros, Luiza Helena (2); Mascareñas, Cesar (3); el Guerche-Séblain, Clotilde (4) 1: Sanofi Pasteur, Brazil; 2: Marilia Medical School and Medical School of the Metropolitan University of Santos, Brazil; 3: Sanofi Pasteur, Mexico; 4: Sanofi Pasteur, France Background and aims The majority of influenza infections are caused by influenza A. However, some seasons are dominated by influenza B with two lineages co-circulating. Much of the scientific literature has focused on influenza A. It seems important that further information on the global burden of influenza type B disease is obtained within the context of the recent launch of new tetravalent influenza vaccines. The aim of this study is to present a review of influenza surveillance data in the Latin American region. Methods An extensive search of published information in PUBMED, SCIELO and WHO, PAHO and Latin American Ministry of Health sites, from January/2000 until March/2014 was performed. After a review of the abstracts, articles were selected based on their relevance. Additional references were included when considered relevant for the review. Results Before 2009, the majority of information about A and B strains circulation was based on passive surveillance of influenza-like illness (ILI), mostly using Immunofluorescence tests. It was observed large variation on influenza strains circulation in the region. On average, FLU A strains were responsible for about 2/3 of ILI cases and B strains, for 1/3. The strain A(H3N2) caused the majority of serious cases, but all A and B FLU strains were identified in ILI and hospitalized cases. Since 2002, there is evidence that both B lineages (Victoria and Yamagata) co-circulated with A(H1N1) and A(H3N2), and in some years, the B strains were the predominant ones (>50%). After 2009, the majority of countries implemented the surveillance for serious acute respiratory syndrome (SARS), and introduced RT-PCR tests. The strain A(H1N1)pdm09 was the predominant one in both, ILI and SARS cases, but the strains A(H3N2) and both B lineages co-circulated in the region, with variable impact in different countries and seasons. Limited information about mismatch pointed that in about 50% of the seasons there was B strain mismatch with the linages included in trivalent vaccines used in Brazil and Mexico, and disproportional impact of B strains in children, adolescents and young adults. Conclusions Influenza A and B caused substantial morbidity and mortality in the region. In about 50% of the last 10 years, there was B strain mismatch with the vaccine recommended for Northern and Southern Hemisphere, and the introduction of a tetravalent vaccine can reduce substantially influenza cases and complications. Note: this study was supported by Sanofi Pasteur 2010 a 2014 A(H1N1)pdm09 % A(H3N2) % A? % B % Total Argentina 3,781 27 2,180 16 5,355 39 2,525 18 13,841 Brasil 4,418 53 1,961 23 135 2 1,860 22 8,374 Chile 2,818 32 3,915 44 411 5 1,675 19 8,819 Colômbia 1,818 60 742 24 322 11 154 5 3,036 Costa Rica 1,491 53 917 32 47 2 363 13 2,818 Ecuador 1,397 53 755 29 181 7 294 11 2,627 México 10,784 54 5,582 28 1,670 8 1,920 10 19,956 Panamá 137 18 373 48 12 2 248 32 770 Paraguay 665 21 1,738 55 12 1 720 23 3,135 2,089 51 945 23 402 10 669 16 4,105 320 35 335 37 8 2 237 26 900 Country Peru Uruguay TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P13 POSTE R A BSTRAC TS SPA1P10 Epidemiology of patients infected by Influenza B viruses in a northern Spanish population during 2012-2013 Influenza season Ortiz de Lejarazu, Raúl (1,2); Rojo, Silvia (1,2); López, Irene (2); López, Cristina (2); Tamames, Sonia (1,3); Sanz, Iván (1,2) 1: Valladolid National Influenza Center, Spain; 2: Microbiology & Immunology Service - Hospital Clinico Universitario de Valladolid, Spain; 3: Conserjería de Sanidad - Junta de Castilla y León, Spain Background Influenza B lineages Victoria and Yamagata have been co-circulating globally since 25 years ago. Before the emergence of A/H1N1 pandemic virus in 2009, Influenza B type viruses appeared as predominant virus every 2-4 years. After 2009 pandemic, 2012-2013 influenza season was the first epidemic with predominant B virus. The aim of this study is to evaluate the characteristics of patients infected by Influenza B viruses Yamagata and Victoria during 2012-2013 influenza season. Methods A retrospective observational and descriptive study was designed selecting 109 patients positives for Influenza B virus from Hospital and Influenza Sentinel Surveillance Network of Castilla y León (ISSN) (Spain). These samples were diagnosed at Valladolid National Influenza Centre and Microbiology and Immunology Service of Hospital Clinico Universitario de Valladolid (Spain), by means of cellular culture, commercial and in-house RT-PCR multiplex molecular techniques. Clinical information as sex, age and other clinical base conditions was extracted from clinical petitions of each patient. Results Globally during 2012-2013 flu season, 30.3% of patients diagnosed for Influenza B infection (33) were hospitalized and 69.7% (76) were non-hospitalized patients. Among hospitalized patients, 66.7% were infected by Influenza B Yamagata lineage and in 27.3% by Victoria lineage (6.1% can ́t be subtyped by molecular assays). Among nonhospitalized patients, 64.5% were diagnosed as Yamagata lineage and 31.6% as Victoria lineage (3.9% can ́t be subtyped by molecular assays). The most affected age group by Influenza B infection was 1-14 years (46.8%) in both lineages, followed by 31-60 age group (26.6%). Globally, prevalence of Influenza B in both lineages was higher in man than woman (62% for Yamagata lineage and 75.6% for Victoria lineage). In the same way, in all age groups described also men was the gender group with higher prevalence of Influenza B infection, however, prevalence was higher for women of 15- 30 age group. Conclusions Although it has been proved the epidemic joint circulation of both lineages of Influenza B, a higher prevalence of circulation of Yamagata lineage in general population and also in hospitalized patients was observed in 2012-2013 influenza season. Most affected age group was 1-14 years, but patients with ages between 31-60 years had also high rates of infection. Yamagata lineage infection had similar sex ratio, but Victoria lineage had higher proportion of infected men. Influenza B is a cause of hospitalization in an important proportion of cases. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P14 POSTE R A BSTRAC TS SPA1P11 Co-circulation of two lineages of influenza B viruses in South Korea Noh, Ji Yun (1); Lee, Han Sol (2); Song, Joon Young (1); Choi, Won Suk (1); Lee, Jacob (3); Seo, Yu Bin (3); Lee, Jin-Soo (4); Wie, Seong-Heon (5); Jeong, Hye Won (6); Kim, Young Keun (7); Park, Kyung Hwa (8); Kim, Shin Woo (9); Lee, Sun Hee (10); Lee, Jung Hwa (11); Kim, Dong Hyun (12); Woo, Sung Il (13); Lim, Chae Seung (14); Cho, Kyung Soon (15); Cheong, Hee Jin (1); Kim, Woo Joo (1,16) 1: Division of Infectious Diseases, Department of Internal Medicine, Korea University College of Medicine, Seoul, Korea; 2: Department of Biomedical Sciences, Korea University College of Medicine, Seoul, Korea; 3: Division of Infectious Diseases, Department of Internal Medicine, Kangnam Sacred Heart Hospital, Hallym University School of Medicine, Seoul, Korea; 4: Division of Infectious Diseases, Department of Internal Medicine, Inha University College of Medicine, Incheon, Korea; 5: Division of Infectious Diseases, Department of Internal Medicine, The Catholic University of Korea, School of Medicine, St. Vincent’s Hospital, Suwon, Korea; 6: Division of Infectious Diseases, Department of Internal Medicine, College of Medicine, Chungbuk National University, Cheongju, Korea; 7: Department of Infectious Diseases, Yonsei University Wonju College of Medicine, Wonju, Korea; 8: Department of Internal Medicine, Chonnam National University Medical School, Gwangju, Korea; 9: Department of Internal Medicine, Kyungpook National University School of Medicine, Daegu, Korea; 10: Department of Internal Medicine, Pusan National University School of Medicine, Busan, Korea; 11: Department of Pediatrics, Korea University College of Medicine, Seoul, Korea; 12: Department of Pediatrics, Inha University College of Medicine, Incheon, Korea; 13: Department of Pediatrics, College of Medicine, Chungbuk National University, Cheongju, Korea; 14: Department of Laboratory Medicine, Korea University College of Medicine, Seoul, Korea; 15: Division of Virology, Busan Metropolitan City Institute of Health and Environment, Busan, Korea; 16: Transgovernmental Enterprise for Pandemic Influenza in Korea, Seoul, Korea Background Two antigenically distinct lineages of influenza B viruses have circulated globally: Yamagata and Victoria lineages. Current trivalent influenza vaccines include only one lineage of influenza B viruses, and it leads to the reduced influenza vaccine effectiveness especially when the predominant circulating influenza B virus does not match vaccine strain. We aimed to characterize the lineages of influenza B viruses obtained from clinical specimens. Methods Respiratory specimens from the patients with laboratory-confirmed influenza B from 2007-2008 influenza season to 2013-2014 season were used. RT- PCR for the partial hemagglutinin gene of influenza B virus was performed to differentiate Yamagata and Victoria lineages and phylogenetic tree was generated. B/Brisbane/60/2008 virus and B/ Wisconsin/01/2010 virus were used as representative strains of Victoria lineage and Yamagata lineage, respectively. Results In South Korea, influenza B viruses generally circulated every two years recently. Therefore, samples of 2007-2008, 2009-2010, 2011-2012, and 2013-2014 influenza seasons were available for the analysis. Victoria lineage influenza B viruses were predominant in 2007-2008 influenza season (42/49, 85.7%) and in 2009-2010 season (90/99, 90.9%). In 2007-2008 and 2009-2010 seasons, the influenza B vaccine strain was well matched to circulating strains. During 2011-2012 season, among 152 samples which lineage was specified, 90 (59.2%) belonged to Yamagata lineage group. Also, in 2013-2014 season, two lineages of influenza B viruses have co-circulated: Yamagata lineage 53.9%(83/154) and Victoria lineage 46.1%(71/154). Among 121 adult patients with influenza B in 2013-2014 season, there was no significant difference in seasonal influenza vaccination rate (27.1% vs. 24.5%, P=0.83) and hospitalization rate (6.9% vs. 10.2%, P=0.52) between patients infected with matched strain (Yamagata lineage) and those infected with mismatched strain (Victoria lineage). Conclusions Co-circulation of two influenza B lineages was found in South Korea. Quadrivalent influenza vaccine would improve the effectiveness of influenza vaccine. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P15 POSTE R A BSTRAC TS SPA1P12 Factors that influence the clinical outcome in patients admitted with influenza like illness and the effect of glucocorticoid treatment Tanriover, Mine Durusu (1); Ozisik, Lale (1); Akcay Ciblak, Meral (2); Yurtcu, Kubra (2); Unal, Serhat (3); Badur, Selim (2) 1: Hacettepe University Faculty of Medicine, Department of Internal Medicine, Ankara, Turkey; 2: Istanbul University, Faculty of Medicine, Department of Microbiology and Clinical Microbiology, Istanbul, Turkey; 3: Hacettepe University Faculty of Medicine, Department of Infectious Diseases and Clinical Microbiology, Ankara, Turkey Background Viral respiratory infections, mainly influenza can be devastating in adults, especially in those with chronic diseases. Severe cases may require hospitalization. Glucocorticoids are questionable in the treatment of viral infections, however patients with chronic obstructive lung disease or severe bronchospasm may require systemic glucocorticoid treatment. Methods Patients admitted from the Adult Emergency Department of a University Hospital were screened for influenza like illness between January 16 and March 16, 2013. Those who required hospitalization for at least 24 hours and who consented were sampled with nasal/nasopharyngeal swab. Samples were collected in Virocult (Medical Vire&Equipment, England) and transferred to the lab for testing. All samples were stored at -80C if not tested upon arrival. High-Pure Viral Nucleic Acid Kit (Roche, Germany) was used for total RNA extraction. CDC rRT-PCR protocol was used for detection of influenza viruses. (http://www.who.int/csr/resources/publications/swineflu/ CDCRealtimeRTPCR_Swine H1Assay-2009_20090430.pdf).In-house multiplex rRT-PCR with TaqMan probes were used for detection of respiratory viruses other than influenza viruses. Results A total of 75 patients were enrolled during the study period. The viral panel yielded at least one viral etiology in 25 of the patients (Table 1). Seven patients died. Those who had a lower body mass index, who smoked and who had a malignancy had a higher mortality rate (Table 2). The mortality rate of the patients diagnosed to have influenza A H1N1pdm09 infection was 23.5%. The only significant difference in terms of laboratory data was the lymphocyte number; those who survived had a higher lymphocyte number than those who died (mean 1289 /mm3 vs 614/ mm3, respectively). Glucocorticoid treatment (either systemic or inhaled) did not have an effect on mortality or admission to intensive care unit. Most of the patients with pneumonia received glucocorticoid therapy than those without pneumonia (82.4% vs 25% respectively). None of the patients who died were vaccinated and only half of them received oseltamivir treatment (p=0.053). Multi-organ failure was the cause of death in most of the fatalities. Conclusions This small, pilot surveillance study has demonstrated that respiratory viral infections may be fatal in adult patients; one fourth of patients who had influenza A infection diagnosed died. Systemic or inhaled glucocorticoid treatment does not seem to have a negative impact on the course of viral respiratory diseases. Smoking, having a malignancy and not receiving oseltamivir therapy and not being vaccinated seemed to be risk factors for death in those patients who were admitted with influenza like illness and who had a viral etiology diagnosed; the statistical significance can probably be demonstrated in future larger studies. Table 1. Viruses that were identified as the etiology of the respiratory infection Table 2. The characteristics of patients with a viral etiology (n=25) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P16 POSTE R A BSTRAC TS Table 1. Viruses that were identified as the etiology of the respiratory infection Table 2. The characteristics of patients with a viral etiology (n=25) Virus Number (%) Influenza A H1N1pdm09 17 (68) İnfluenza A 1 (4) Influenza A H3N2 1 (4) Rhinovirus Age Survived discharge 67 (26-90) Female/male to Died p 72 (18-88) NS 9/9 1/6 NS Body mass index 25.2 (19.3-45.1) 21.5 (19.5-35.2) NS 3 (12) Smoking 9 (50) 5 (71.4) NS Parainfluenza virus type 2 1 (4) Pregnancy 1 (5.6) 0 NS Parainfluenza virus type 2 + metapneumovirus CoronavirusOC43 1 (4) Chronic heart disease 10 (55.6) 3 (42.9) NS COPD 10 (55.6) 3 (42.9) NS Diabetes 5 (27.8) 2 (28.6) NS Renal disease 6 (33.3) 1 (14.3) NS Malignancy 3 (16.7) 3 (42.9) NS İmmune suppression 3 (16.7) 1 (14.3) NS Rheumatological disease 2 (11.1) 0 NS Neuromuscular disease 0 1 (14.3) NS Chronic liver disease 1 (5.6) 0 NS Influenza A infection 15 (83.3) 3 (50) NS Oseltamivir treatment 17 (94.4) 4 (57.1) NS Antimicrobial treatment 16 (88.9) 7 (100) NS Glucocorticoid treatment 12 (66.7) 4 (57.1) NS Influenza vaccination in 4 (22.2) 2012-13 season Pneumonia 10 (55.6) 0 NS 7 (100) 0.057 Respiratory failure 9 (50) 7 (100) 0.027 Acute respiratory distress 0 2 (28.6) 0.070 Acute renal failure 2 (11.1) 6 (85.7) 0.001 Acute liver dysfunction 0 5 (71.4) <0.001 Heart failure 2 (11.1) 1 (14.3) NS Disseminated intravascular coagulation Sepsis 0 1 (14.3) NS 0 6 (85.7) <0.001 Encephalitis 1 (5.6) 0 NS Intensive care admission 3 (16.7) 1 (14.3) NS 1 (4) NS, statistically nonsignificant (p >0.05); COPD, chronic obstructive pulmonary disease TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P17 POSTE R A BSTRAC TS SPA1P13 Differentiation of influenza A(H3N2) variant viruses from human seasonal A(H3N2) viruses by real-time RT-PCR Bo Shu, Kai-Hui Wu, William Davis, LaShondra Berman, Christine Warnes, Shannon Emery, Nathelia Barnes, Lakshmi Malapati, Julie Villanueva and Stephen Lindstrom Influenza Division, Centers for Disease Control and Prevention, Atlanta, GA Background Influenza A(H3N2) variant (A(H3N2)v) viruses have been detected in humans in the United States (US) every year since 2009, and from 2011-2013 greater than 300 cases have been identified. A(H3N2)v virus is a swine-origin influenza virus that circulates enzootically in US swine populations that posses the hemagglutinin (HA) and neuraminidase (NA) genes originating from human A(H3N2) viruses that were introduced into swine population in late 1990s and have since evolved independently from human seasonal A(H3N2) viruses. Subsequent evolutionary divergence of the respective HA genes of human A(H3N2) viruses and swine A(H3N2) viruses allows for differentiation by genetic analysis. We have developed a real-time RT-PCR (rRT-PCR) assay to rapidly differentiate A(H3N2)v viruses found in the US from human seasonal A(H3N2) viruses. Materials and Methods Analytical performance of rRT-PCR assays designed to differentiate the HA gene of A(H3N2)v viruses (H3v) from human seasonal A(H3N2) viruses (H3s) were evaluated by testing ten-fold serial dilutions of RNA extracted from recent A(H3N2) vaccine seed viruses A/Perth/16/2009 and A/Victoria/361/2011, as well as A(H3N2)v candidate vaccine viruses A/West Virginia/06/2011 and A/Minnesota/11/2010. Reactivity of the H3v and H3s assays was further evaluated by testing other seasonal human A(H3N2), A(H3N2)v viruses as well as other human and animal influenza virues. Performance of H3v/H3s rRT-PCR assays with clinical specimens was demonstrated by testing 329 A(H3N2)v suspect respiratory specimens and 20 human seasonal A(H3N2) specimens received by CDC from the US state public health laboratories in 2012 and 2013. Using the CDC Human Influenza Virus Real-Time rRT-PCR Diagnostic Panel (CDC Flu rRT-PCR Dx Panel), all 329 A(H3N2)v suspect specimens were positive for universal influenza A (InfA; M gene target), pdm influenza A (pdmInfA; NP gene target) and H3 (HA gene target) assays, and were negative for H1 and pandemic H1 (pdmH1; HA gene target ) assays. Results The analytical performance studies demonstrated the H3v and H3s assays are comparable to CDC InfA rRT-PCR assay. Cross reactivity was not observed when human seasonal influenza A(H3N2) viruses were tested against H3v assay, or when A(H3N2)v viruses were tested against H3s assay. Likewise, H3v and H3s assays did not react with influenza A viruses of other subtypes. The H3v and H3s assays demonstrated 100% agreement when testing 329 human specimens that were confirmed positive for A(H3N2)v and 20 specimens confirmed positive for human A(H3N2). Conclusion The H3v and H3s rRT-PCR assays specifically detect A(H3N2)v viruses and human seasonal A(H3N2) viruses, respectively. Use of both assays allow for rapid differentiation of A(H3N2)v viruses found in the US from human seasonal A(H3N2) viruses when used in conjunction with CDC Flu rRT-PCR Dx Panel. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P18 POSTE R A BSTRAC TS SPA1P14 Performance validation of CDC real-time RT-PCR influenza assays on the AB TaqMan Array Card Kai-Hui Wu, C. McCord, B. Shu, C. Warnes, and S. Lindstrom Influenza Division, Centers for Disease Control and Prevention, Atlanta, GA, USA Background The TaqMan® Array Card (TAC) is a 384 microfluidic card that enables simultaneous testing of up to 48 real-time PCR assays on the AB ViiA7 platform. The CDC real-time RT-PCR (rRT-PCR) influenza assays are designed for universal detection of influenza type A and B, and determination of influenza A subtypes and discrimination of influenza A and B genotypes on 96-well format thermocycler systems such as the Applied BiosystemsTM (AB) 7500 Fast Dx. In this study we evaluated the performance of the CDC rRT-PCR influenza assays on TAC on the AB ViiA7 Real-Time PCR. Materials and Methods Performance of twelve rRT-PCR assays for detection and characterization of influenza including A(H3), A(H3)v, A(H1pdm09), avian A(H5), A(EuH7), B(Victoria lineage) (VIC), and B(Yamagata-lineage) (YAM) were compared by performing side-by-side limit of detection (LoD) analysis with TaqMan® array cards on the ViiA7 system and 96well plates on the AB 7500 Fast Dx system. Serial dilutions of viral RNA were tested with both systems using the same reagent preparation. The LoD for each primer and probe set was calculated to indicate the range of lowest detectable concentration of influenza virus at which ≥95% of all replicates tested positive. Assay reactivity with clinical specimens was evaluated by testing specimens positive for influenza A(H3N2), A(H3N2)v, A(H1N1), A(H1N1pdm09), B(YAM), B(VIC), as well as specimens negative for influenza A and B. Results & Conclusion All assays tested showed comparable sensitivity on ViiA7 when compared with AB 7500 Fast Dx. Sensitivity of the assays was approximately 5 fold lower on TAC when 46uL RNA per 100uL reaction was tested on the TAC compared with 5 uL RNA per 25 uL reaction on AB 7500 Fast Dx system. This is expected due to the substantially lower reaction volume of the microfluidic array (approximately 1.4uL per reaction). Performance when testing 96 positive and 30 negative clinical specimens for influenza showed 100% agreement between both formats. Results from this evaluation demonstrated that CDC Flu rRT-PCR assays can be used in the TAC microfluidic format on the ViiA7 instrument with limited loss of sensitivity and that the influenza rRT-PCR assays performed comparably on TAC and 96-well formats. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P19 POSTE R A BSTRAC TS SPB1: VIRUS STRUCTURE AND REPLICATION SPB1P01 Application of next-generation sequencing technologies to study the evolution of H5N2 avian influenza viruses in Taiwan Shieh, Happy K. (1); Cheng, Ming-Chu (2); Chang, Poa-Chun (1) 1: National Chung Hsing University, Taiwan, Republic of China; 2: Animal Health Research Institute, Taiwan, Republic of China Background Sporadic outbreaks of low pathogenic H5N2 influenza viruses have occurred in Taiwan since 2003. The aim of this study was to investigate the change in the virulence and HA cleavage site sequence of the H5N2 viruses after consecutive passages in chicken embryonic eggs. Methods The low pathogenic H5N2 virus isolated in Taiwan in 2003 was serially passaged in 14‐day‐old chicken embryonic eggs. The viruses obtained at 5th, 10th, 20th, 30th, 40th and 50th passages were collected. The intravenous pathogenicity index (IVPI) of these viruses were determined, and the sequence of the HA, NA and PB2 genes of the viruses were determined by RT‐PCR combined with next‐generation sequencing analysis. Results Before the passage, the H5N2 virus isolated in 2003 had an IVPI of 0 and contained only three basic amino acids (REKR) at the HA cleavage site. At the 10th passage, the IVPI of this virus increased to 0.45 and heterogeneity in the HA cleavage sequence was observed. Namely, about 53% of the virus contained three basic amino acids (REKR) at the HA cleavage site, 11% contained four basic amino acids (RKKR), 35% contained five basic amino acids (RRKKR or RKKKR) and 0.4% contained six basic amino acids (RRRKKR). At 20th and 30th passages, the IVPI of the virus increased to 1.45 and the percentages of viruses containing four or more basic amino acids increased. All the viruses examined in this study did not contain E627K mutation at their PB2 protein, and the number of amino acid deletion at the stalk region of the NA protein is stable. Conclusions The low pathogenic H5N2 viruses isolated in Taiwan could mutate into high pathogenic viruses. This result highlights the importance of eradication of these viruses even when they are low pathogenic. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P20 POSTE R A BSTRAC TS SPB1P02 Replication of MDCK-adapted viruses with different receptor specificity in vitro and in vivo Kuznetsova, Victoria; Isakova-Sivak, Irina; Rudenko, Larisa Institute of Experimental Medicine RAMS, Russian Federation Background Influenza pandemics are caused by influenza viruses that switch receptor binding preference from avian-like α2,3– sialic acid (SA) to the human-like α2,6–SA receptors. To model the natural process of virus adaptation to a new host eggs can be used as avian-type cells which predominantly express α2,3–SA and MDCK cells may be used as mammalian host. During adaptation to the new host viruses usually gain mutations in their surface proteins – hemagglutinin (HA) and neuraminidase (NA). It is not fully understood how these mutations may influence the main viral properties such as virulence, replication, transmissibility, immunogenicity and antigenicity. Materials and Methods A pair of highly related influenza viruses derived from A/Singapore/1/57 (H2N2) heterogeneous population was used in this study. These viruses differed by three amino acids in their HA: E156K, Q226L and G228S (H3 numbering), where EQG variant displayed α2,3–SA receptor binding specificity, whereas KLS had α2,6–SA receptor specificity. Adaptation of H2N2 viruses to MDCK cells was performed by their serial passaging at MOI=0.001. Cloning of the virus population was performed by plaque purification on MDCK cells. HAs of MDCK-adapted viruses were sequenced to find adaptive changes. Replication of the viruses in vitro was assessed by EID50/ml and TCID50/ml. Five viruses differing by their HAs were used to infect groups of 4 female CBA mice by i.n. route at a dose of 105.0EID50. Results Adaptation of KLS variant to MDCK cells resulted in acquisition of two mutations in HA1: G158E and L321P (KLS–EP). Residue 158 is located in receptor binding site, and receptor specificity of the MDCK-adapted variant significantly changed. Adaptation of the EQG variant to MDCK cells resulted in two clones with substitution P221S in HA1 (EQG–S) and A96V HA2 (EQG–V). All EQG variants showed high titers in eggs (8.5-8.9 log10EID50/ml) whereas their titers in MDCK cells significantly varied: the titer of EQG variant didn’t exceed 7.4 log10TCID50/ml while EQG–S and EQG–V variants grew to the titers over 8.6 log10TCID50/ml. KLS virus replication was low efficient in both substrates (6.7 log10EID50/ml vs 7.1 log10TCID50/ml) whereas KLS–EP variant demonstrated increased replication in MDCK cells (7.3 log10EID50/ml vs 8.3 log10TCID50/ml). Replication of all EQG variants in nasal turbinates of mice was undetectable whereas their titers in lungs significantly varied: 4.4 log10TCID50/ml for EQG variant and 6.5 log10TCID50/ml for EQG–S and EQG–V variants. In contrast, KLS variants were able to replicate in nasal turbinates (2.2-3.1 log10TCID50/ml) and titers in lungs were comparable: 5.8 log10TCID50/ml for KLS and 6.3 log10TCID50/ml for KLS–EP variant. Conclusions MDCK-adapted mutations of influenza viruses with avian-type receptor specificities affect viral replication in mammalian cells which can have an impact on virus virulence, transmissibility, immunogenicity and antigenicity. This work was supported by RFBR Grant No No14-04-32088. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P21 POSTE R A BSTRAC TS SPB1P03 Structural insight into extracellular domain of matrix protein 2 of influenza A virus Kim, Kyung Hyun (1); Cho, Ki Joon (1,2,3); Schepens, Bert (2,3); Seok, Jong Hyeon (1); Kim, Sella (1); Rose, Kenny (2,3); Lee, Ji-Hye (1); Gallardo, Rodrigo (4); Schymkowitz, Joost (4); Rousseau, Frederic (4); Fiers, Walter (2,3); Saelens, Xavier (2,3); Chung, Mi Sook (5) 1: Korea University, Korea, Republic of South Korea; 2: VIB Inflammation Research Center, 9052 Ghent, Belgium; 3: Department of Biomedical Molecular Biology, Ghent University, 9052 Ghent, Belgium; 4: VIB Switch Laboratory, Department for Cellular and Molecular Medicine, Katholieke Universiteit Leuven, 3000 Leuven, Belgium; 5: Department of Food and Nutrition, Duksung Women’s University, Seoul 132-714, Kore Background The extracellular domain of matrix protein 2 (M2e) of influenza A is extensively explored as a universal influenza A vaccine candidate because of its strong sequence conservation. Although crystal structures of the extracellular domain of HA and NA have been known, either as a free form or as a complex form with an Fab of monoclonal antibodies, the ectodomain structure of M2 has remained elusive. Methods M2e-tGCN4 and M2e-Fab65 complex were characterized by biochemical methods and their structures were solved by X–ray crystallography. Mutation studies and reverse genetics system were also used. Results FTIR and crystallographic studies of M2e-tGCN4 revealed that the leucine zipper domain of M2e-tGCN4 is superimposed well with the transmembrane domain of M2 determined by high resolution NMR, but M2e was invisible possibly due to high flexibility (Figure 1). In contrast, the M2e-Fab65 complex crystal structure showed that the complementary determining regions interact with M2e that adopts a compact U-shaped conformation (Figure 2). Several highly conserved M2e residues are critical for interaction with Fab65: Trp15 is essential for stabilizing the conformation of M2e and Glu6 and Glu8 are critical for antibody binding. Conclusions We determined the structures of M2e and its complex with Fab fragment of an M2e-specific monoclonal antibody 65 (mAb65). M2e appears to have an extended conformation and is highly flexible, whereas it adopts a U-shaped conformation that is stabilized by the engagement of crucial residues that are highly conserved among human and nonhuman influenza A viruses. This work was supported by grants from Mid-career Researcher Program (2010-0029242) through NRF funded by the MEST and from TEPIK (A103001) funded by the Ministry for Health, Welfare & Family Affairs, Korea. Figure 1. Structure of M2e-tGCN4. The leucine zipper domain of M2e-tGCN4 is superimposed well with that of M2 determined by NMR (green and marine colors, respectively), whereas M2e was invisible possibly due to high respectively), whereas M2e was invisible possibly due to high flexibility (orange and red) flexibility (orange and red) Figure 1. Structure of M2e-tGCN4. The leucine zipper domain of M2e-tGCN4 is superimposed well with that of M2 determined by NMR (green and marine colors, TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P22 POSTE R A BSTRAC TS Leu3 cys19 Figure 2. Structures ofwith M2e within Fab65. The Fab (marine and green) in complex with M2e (magenta) Figure 2. Structures of M2e complexed Fab65.complexed The Fab (marine and green) complex with M2e (magenta) (upper panel) and the compact U-shaped conformation of (upper panel) and the compact U-shaped conformation of M2e (lower panel). M2e (lower panel). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P23 POSTE R A BSTRAC TS SPB1P04 The transmembrane domain of influenza NA has co-evolved with the distal head domain da Silva, Diogo V; Nordholm, Johan; Dou, Dan; Daniels, Robert Stockholm University, Sweden Abstract Transmembrane domains (TMDs) from single-spanning membrane proteins are commonly viewed as hydrophobic membrane anchors for functional domains. Influenza neuraminidase (NA) exemplifies this concept as it retains enzymatic function upon proteolytic release from the membrane. However, we recently showed the NA TMDs have become increasingly less hydrophobic in human H1N1 viruses, which suggests the TMD is changing to maintain compatibility with the distal enzymatic head domain. Here, we investigated this relationship by analyzing an ‘old’ 1933 H1N1 virus (WSN33) where the amphipathic NA TMD was exchanged for a ‘contemporary’ 2009 subtype 1 NA TMD, and an engineered hydrophobic TMD. Each exchange decreased the NA folding efficiency resulting in significant fitness loss in viral replication at 37°C, but very little loss at 33°C where NA folds more efficiently. The chimera viruses restored the viral infectivity and NA folding efficiency at 37°C by selecting for mutations in the NA TMD, which corresponded with their assembly properties (polar/hydrophobic). These results likely explain why the amphipathic NA TMD in H1N1 viruses became more polar with subsequent changes in the head domain, and show that the folding equilibrium of NA can significantly impact viral replication likely by altering the enigmatic ‘HA-NA’ equilibrium. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P24 POSTE R A BSTRAC TS SPA2: EPIDEMICS AND PANDEMIC THREATS SPA2P01 Application of next-generation sequencing technologies to study the evolution of H5N2 avian influenza viruses in Taiwan Wong, Jessica Y. (1); Kelly, Heath (2,3); Cheung, Chung-Mei M. (4); Shiu, Eunice Y. (1); Wu, Peng (1); Ni, Michael Y. (1); Ip, Dennis K. M. (1); Cowling, Benjamin J. (1) 1: School of Public Health, Li Ka Shing Faculty of Medicine, The University of Hong Kong, Hong Kong Special Administrative Region, China; 2: Victorian Infectious Diseases Reference Laboratory, North Melbourne, Victoria, Australia; 3: National Centre for Epidemiology and Population Health, Australian National University, Canberra, Australian Capital Territory, Australia; 4: Medical School, University College London, London, United Kingdom Background During the 2009 influenza pandemic, uncertainty surrounding the seriousness of human infections with the H1N1pdm09 virus hindered the calibration of the public health response. One measure of seriousness is the hospitalization fatality risk (HFR), defined as the probability of mortality among cases of H1N1pdm09 who required hospitalization for medical reasons. The objective of our study was to review published data on the HFR of H1N1pdm09. Methods We searched for relevant studies in PubMed, MEDLINE and EMBASE. Studies that reported population-based estimates of the HFR for H1N1pdm09 were included. We excluded studies that reported estimates of the HFR in population subgroups such as pregnant women or those at higher risk of severe outcome if infected (e.g. individuals with underlying chronic diseases). Results We included 187 estimates of the HFR from 184 published studies, reporting a total of 151,754 hospitalized cases and 7,010 deaths. In total, our analysis was based on reports from 49 countries or regions in every continent except Antarctica. We identified heterogeneity in published HFR estimates, with crude estimates of the risk of death ranging from 0% to 48% but in wealthy countries the estimate ranged from 1% to 4%. The point estimates of the HFR increased substantially with age, with lower GDP and in second and subsequent years of H1N1pdm09 circulation. In children, the HFR of H1N1pdm09 and inter-pandemic influenza did not have substantial difference. Conclusions There was some variability in published estimates of the HFR, but much less variability than we found in our review of published estimates of the case fatality risk (Wong J et al., 2013 Epidemiol). Lower HFR in children could be due to reduced seriousness of infection, or a lower threshold for admitting children. Early in the next pandemic, estimation of the HFR may provide a reasonable picture of seriousness of infection and thereby inform risk assessment of the severity of the pandemic strain, particularly if presented in comparison with HFR for inter-pandemic influenza in similar setting. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P25 POSTE R A BSTRAC TS SPA2P02 Real-time estimation of the hospitalization fatality risk of influenza A(H1N1)pdm09 in Hong Kong Wong, Jessica; Tsang, Tim K.; Wu, Peng; Lau, Eric H. Y.; Ip, Dennis K. M.; Cowling, Benjamin J. School of Public Health, Li Ka Shing Faculty of Medicine, The University of Hong Kong, Hong Kong Special Administrative Region, China Background During the early stage of an epidemic, timely and reliable estimation of the seriousness are important for predicting the impact that the influenza viruses will have in the population. The hospitalization fatality risk (HFR), which is a measure of seriousness of infection, is defined as the probability of death among cases who required hospitalization for medical reasons. The objective of our study was to determine optimal methods for real-time estimation of the HFR of H1N1pdm09 in 2009 in Hong Kong. Methods We obtained age-specific deaths and hospitalizations among patients with laboratory-confirmed H1N1pdm09 infections from May 2009 through July 2010 from the Hong Kong Hospital Authority. We estimated HFR in real-time, using crude estimation or allowing for right-censoring for final status in some patients (Jewell et al., 2007 Stat Med; Garske et al., 2009 BMJ) using Bayesian inference. Results We applied the four different estimators to the H1N1pdm09 data and found that the estimate was relatively stable. Models allowing for censoring preformed better than models without adjustments. We were able to obtained reliable estimates of HFR in mid-September, early-September and mid- October for 20-44y, 45-64y and ≥65y respectively. The risk of deaths among hospitalized patients with confirmed H1N1pdm09 increased with age, with point estimates ranging from approximately 1% in younger adults to 5% in the elderly. Conclusions We obtained reliable estimate of the HFR before the peak of the 2009 pandemic in adults but after the peak in the elderly using models allowing for censoring. Unable to obtain timely HFR estimate in the elderly until could be due to very few deaths at the early stage of the pandemic. During an ongoing epidemic, we would be able to obtain reasonable real-time estimates of theseriousness of human infection, if appropriate models are prepared in advance. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P26 POSTE R A BSTRAC TS SPA2P03 Improving Standardisation and Timeliness of Seroepidemiological Studies through the Global Partnership CONSISE (the Consortium for the Standardization of Influenza Seroepidemiology) Van Kerkhove, Maria D (1); Laurie, Karen (2); Engelhardt, Othmar (3); Wood, John (4); ., CONSISE (5) 1: Imperial College London, United Kingdom; 2: WHO Collaborating Centre for Reference and Research on Influenza, Melbourne, Australia; 3: Division of Virology, National Institute for Biological Standards and Control, United Kingdom; 4: Formerly Division of Virology, National Institute for Biological Standards and Control, United Kingdom; 5: Consortium for the Standardization of Influenza Seroepidemiology Background Serological studies can detect infection with influenza viruses in the absence of symptoms or virus detection, providing additional information on infection beyond estimates from epidemiological, clinical and virological data. Identification of both asymptomatic and symptomatic infections enables estimates of severity and transmissibility for a novel influenza virus to be calculated. Furthermore, possible susceptible populations can be identified and the potential impact of a novel influenza virus estimated. A large number of serological studies were conducted in 2009 and 2010 describing the impact of the pandemic influenza virus around the world. However the timing of many publications limited their usefulness to inform public policy and differences in methodology made direct comparison of studies difficult. Methods In 2011, CONSISE, the Consortium for the Standardization of Influenza Seroepidemiology, a global partnership, was formed to develop influenza investigation protocols and standardise seroepidemiology to inform public health policy. The activities of CONSISE are performed by two inter-linked working groups, laboratory and epidemiology, and a steering committee. Results The Epidemiology Working Group is developing several generic yet comprehensive epidemiological, virological and serological protocols for influenza and other respiratory viruses and question banks to facilitate rapid and informative studies. The Laboratory Working group focuses on improving serological assay comparability and standardisation through consensus assay development, comparative laboratory testing and quality assurance. Two comparative laboratory studies assessing microneutralisation (MN) assay protocols have been performed. A third comparative laboratory study assessing the Enzyme-linked lectin assay (ELLA), that detects antibodies to neuraminidase, is underway. A further comparison of both MN and haemagglutination inhibition assay protocols will begin in late 2014. Conclusions CONSISE is playing a role in public health evaluation and management of newly emerging respiratory agents, including MERS-CoV and A(H7N9). Our materials are open access and shared on the Global Health Network website (http://CONSISE.tghn.org/). We seek additional members from public health agencies, academic institutions and other interested parties. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P27 POSTE R A BSTRAC TS SPA2P04 INFLUENZA EPIDEMIC SEASON 2013-2014 IN RUSSIA: CHARACTERISTICS OF ISOLATED STRAINS Eropkin, Mikhail; Danilenko, Daria; Konovalova, Nadejda; Komissarov, Andrey; Pisareva, Maria; Grudinin, Mikhail; Lobova, Tamara; Schekanova, Svetlana; Kornilova, Ekaterina; Eropkina, Elena; Suddenkova, Polina Research Institute of Influenza, Saint-Petersburg, Russian Federation Background influenza surveillance in Russian Federation during 2013-2014 epidemic season. Methods virus isolation, identification, antigenic analysis in HI-test, sequencing, phylogenetic analysis, MUNANA-test of sensitivity to neuraminidase inhibitors. Results Epidemic season 2013-2014 in Russia was characterized by a relatively low intensity. By the end of April only 739 strains were isolated, among them 366 strains (49,5%) – influenza А/H1N1рdm09, 333 strains (45 %) – influenza A/H3N2 and only 35 strains (4,7%) – influenza B. The essential exceeding of the epidemic morbidity thresholds was observed only in the Far East where more than 130 strains were isolated. Nevertheless in this season we succeeded to isolate, antigenically characterize and sequence three pre-epidemic strains – A/St.Petersburg/428/13(H3N2), A/ Moscow/18/13 (H1N1)pdm09 and B/Khabarovsk/43/13 which were isolated in October-December 2013. In the Asian part of Russia the prevailing strains were А/H1N1pdm09 (89,5 % of all isolates) while in the European part – А/ H3N2 (78,5 %). The impact of influenza B into the epidemic process was minor (3,7 % of all isolated strains). Antigenic analysis in HI-test has shown in general the conformity with the strain composition of seasonal flu vaccines proposed by the WHO. Influenza virus А/H1N1pdm09 were similar to the reference strain A/California/07/09, while a slight gradual drift was observed (HI-titer of a part of strains was 4-8-fold of homological titer). Sequencing of those strains has demonstrated their belonging to sub-clade 6B (similar to the etalon А/Stockholm/15/13). Viruses А/H3N2 were similar to the etalon A/Texas/50/12 with aminoacid substitutions specific for the sub-clade 3C.3 A/Victoria/361/11like strains (a typical representative - A/Samara/73/13). We did not reveal any mutations of resistance to oseltamivir and zanamivir in the sequences of neuraminidase gene of all analyzed strains but all of them were genetically resistant to rimantadine. All analyzed strains proved to be sensitive to the neuraminidase inhibitors also according the results of the fluorescent MUNANA-test. Between the analyzed influenza B strains 3 strains isolated in St.Petersburg, Yekaterinburg and Vladivostok belonged to Yamagata lineage (B/Massachusetts/2/12-like) while 2 strains from Khabarovsk were of Victorian lineage (B/Brisbane/60/08-like). Its HA gene belonged to the clade 1A. Conclusions The conformity of strains circulated on the territory of Russia with the WHO-proposed strain composition of influenza vaccines for the epidemic season 2014-2015 was endorsed on the session of the National Commission on vaccine and diagnostic influenza strains which took place in the Research Institute of Influenza on Feb. 27 2014. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P28 POSTE R A BSTRAC TS SPA2P05 Excess mortality risk attributable to influenza infection in Hong Kong, 1998-2012 Wu, P (1); Goldstein, E (2); Ho, LM (1); Wu, JT (1); Ip, DKM (1); Leung, GM (1); Cowling, BJ (1) 1: School of Public Health, The University of Hong Kong, Hong Kong S.A.R. (China); 2: 2Center for Communicable Disease Dynamics, Department of Epidemiology, Harvard School of Public Health, Boston, MA, USA Background Seasonal influenza viruses have caused considerable morbidity and mortality in humans. Estimates from previous studies indicated that the disease burden attributable to influenza virus infection was much more substantial than the observed influenza cases confirmed by laboratory testing. We aimed to estimate the excess mortality from major underlying causes associated with different influenza types and subtypes in Hong Kong, a subtropical city with influenza circulating throughout the year, from 1998 through 2012. Methods We used multi-linear regression models to fit age and sex-specific all-cause and cause- specific mortality rates in Hong Kong from 1998 to 2012. The model allows activities of different types/subtypes of influenza virus and co-circulating respiratory syncytial virus to be adjusted as the product of influenza-like-illness consultation rates from sentinel surveillance and laboratory detection rates of each specific virus (Wu P et al., J Infect Dis 2012). Environmental factors and periodic temporal trends in mortality rates during the study period were also adjusted. The influenza-associated excess mortality was measured as the differences between estimated mortality rates in the presence or absence of influenza activity in the model. Sex-specific attributable fractions were estimated for each cause of death. Results The annual influenza-associated all-cause excess death rates varied between 7 and 14 per 100,000 person-years in 1998-2012 during which influenza A(H3N2) contributed more than half of the deaths attributed to influenza. On average, influenza caused higher mortality rate in men than in women. The attributable fractions of influenzaassociated excess mortality were generally higher in women than in men in different causes of death except for cardio-respiratory death. Most influenza-associated excess deaths occurred in the elderly both for men and women. Cardio-respiratory diseases accounted for more influenza-associated excess deaths in men in women. Conclusions Influenza was associated with a substantial number of deaths in Hong Kong between 1998 and 2012 in both men and women particularly in the elderly. Cardio-respiratory diseases accounted for the majority of the influenza associated excess deaths in both sexes especially among men although the proportion of excess cardiovascular deaths was relatively lower in Hong Kong than western countries. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P29 POSTE R A BSTRAC TS SPA2P06 Community psychological and behavioral responses to the threat of A(H7N9) in Hong Kong Wu, P; Fang, VJ; Liao, Q; Ng, DMW; Wu, JT; Leung, GM; Fielding, R; Cowling, BJ School of Public Health, The University of Hong Kong, Hong Kong S.A.R. (China) Background The novel influenza A(H7N9) virus has causes epidemics of infections in poultry and humans since its first detection although evidence suggested that the risk of human-to-human transmission is low. Laboratory-confirmed human cases dramatically decreased following the closure of live poultry markets in affected cities in China. While risk of H7N9 appears to be low in Hong Kong, nine H7N9 cases among Hong Kong residents have been reported since December 2013. We therefore conducted a study aiming to measure levels of exposure to live poultry, risk perception, psychological and behavioral responses towards H7N9, and attitudes towards specific control measures at different stages of the epidemic in the population. Methods A series of cross-sectional population surveys were conducted in 2013. The first survey was carried out on in April shortly after the first H7N9 case was announced in mainland China. A second survey was conducted in December once incidence of human cases of H7N9 began to rise in the winter and the first local case was notified in Hong Kong. Subjects who were Cantonese/Mandarin- speaking Hong Kong Chinese adults (≥18 y) were selected for interview through randomly dialed landline numbers generated by computer. The questionnaire included demographics and items investigating the state of anxiety, H7N9- related risk perception, attitudes towards closure of live poultry markets. Results There were 1,556 and 1,000 interviews completed during the April and December surveys with response rates of 68.9% and 68.0%, respectively. The level of general anxiety in the population remained low. Respondents reported low perceived susceptibility of infection, lower perceived severity of influenza A(H7N9) than SARS, higher perceived severity of influenza A(H7N9) than influenza A(H5N1) and seasonal influenza, and low levels of influenza-like symptoms induced worry. Across the population, the average numbers of annual visits to live poultry markets in Hong Kong and mainland China to be 17.6 and 0.53 visits per person, respectively. A total of 17.5% respondents reported avoidance of visiting live poultry markets because of influenza A(H7N9), whereas 35.9% reported that they would support permanent closure of markets. Younger age, lower educational attainment, and visit to live poultry markets >1 time in the preceding year were independently associated with a lower probability of support for market closures. Conclusions Our study identified generally low anxiety levels among the population in Hong Kong related to the threat of influenza A(H7N9). Higher symptom-induced worry and higher perceived severity of influenza A(H7N9) compared with seasonal influenza were associated with avoidance of live poultry markets. Our results suggested that obtaining support from the public for permanent closure of live poultry markets might be difficult, particularly among younger adults and adults with lower educational attainment. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P30 POSTE R A BSTRAC TS SPA2P07 The avian origin H9N2 polymerase, common to multiple human lethal strains, possesses robust activity in mammalian cells Cox, Andrew George (1,2); Kim, Yoel (1); O’Dell, Colleen (1); Schmierer, Jordana (1); Smith, Andrew (1,2); Dewhurst, Stephen (1) 1: Department of Microbiology and Immunology, University of Rochester School of Medicine and Dentistry, United States of America; 2: University of Medical Scientist Training Program, University of Rochester School of Medicine and Dentistry, United States of America Background Influenza A Viruses (IAV) adapted to their natural avian host do not normally replicate in mammalian cells due to multiple restrictions. In order to replicate effectively in humans, IAV require both adaptive mutations within the polymerase as well as within hemagglutinin to allow for efficient mammalian infection and replication. Contrary to this dogma, the H9N2 virus (A/quail/Hong Kong/G1/97) that donated the internal segments to the lethal H5N1 virus replicates efficiently in a human lung epithelial cell line at 37oC. Interestingly, this viral polymerase does not possess any of the previously described mutations required for mammalian adaptation including PB2 627K and PB1 99Y. Of further interest, the novel H7N9 and H10N8 viruses also contain a H9N2 polymerase. We therefore hypothesize that the avian H9N2 polymerase may be uniquely primed for function in mammalian cells, and that it has acquired this functionality through a novel mechanism. Methods We used luciferase based mini genome reporter assays to assess viral polymerase activity, beginning with either a vRNA or cRNA template of varying lengths in mammalian A549 cells and avian DF-1 cells at physiologically relevant temperatures. We compared this avian origin H9N2 virus to a well-studied avian origin virus A/chicken/ Nanchang/03-120/2001 H3N2, known to have restricted polymerase activity in mammalian cells. We also have compared activity to the avian polymerase of A/wild bird/Korea/A14/2011 H7N9 that donated the N9 segment to the human lethal H7N9 viruses. As positive controls we have utilized the well characterized mammalian adapted A/ WSN/1933 H1N1 and A/Puerto Rico/8/1934 H1N1 polymerases. Results We observed that the H9N2 polymerase has robust activity in mammalian cells at 37 and 39oC with all templates, but low levels of activity at 33oC. Surprisingly; this H9N2 polymerase has greater activity than the prototypical mammalian adapted strains of PR8 and WSN at 37 and 39oC, but lower at 33oC. The residues of the H9N2 polymerase that enable this increased activity within mammalian cells are located with the PB2 and PA segments. Conclusions The polymerase of A/quail/Hong Kong/G1/1997 H9N2 displays robust activity in mammalian cells despite not possessing mammalian amino acid identity at the previously described amino acids. Through further characterization we have identified a cohort of novel residues within the N termini of PA and middle of PB2 that permit avian origin polymerases to function within mammalian cells. These results suggest that the H9N2 avian IAV polymerase has unique properties that may account for the serial incorporation of this polymerase into avian influenza virus reassortants capable of infecting humans. Future studies will identify specific amino acid residues with the viral PA and PB2 segments that contribute to this phenotype, and thereby elucidate the mechanism underlying the unique functional characteristics of the H9N2 avian IAV polymerase. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P31 POSTE R A BSTRAC TS SPA2P08 The Global Influenza B Study (GIBS): a Research Platform for the Study of Influenza B Paget, John (1); Caini, Saverio (1); Huang, Sue (2); Ciblak, Meral (3); Schellevis, Francois (1); Plotkin, Stanley (4) 1: NIVEL, The Netherlands; 2: The WHO National Influenza Centre, Institute of Environmental Science and Research, New Zealand; 3: Istanbul University, Istanbul, Turkey; 4: Univesity of Pennsylvania, Philadelphia, USA Background Background: Much of the scientific literature to date has focused on influenza A in temperate countries, and we still have a relatively poor understanding of the epidemiology of influenza B, especially in the inter-tropical belt. Launched in 2012, the Global Influenza B Study (GIBS) collects surveillance data on influenza B worldwide in order to support influenza prevention and control policies around the world. Methods We contacted National Influenza Centres in 43 countries and asked for surveillance data during 2000-2013. Each country was asked to provide: the weekly number of reported influenza cases broken down by age group, virus type/subtype and lineage (for influenza B); the weekly influenza-like illness (ILI) or acute respiratory illness (ARI) rates per 100,0000 population or 100 consultations. Large countries that covered multiple climatic regions we asked to provide regional data. Participating countries were also asked to complete a brief questionnaire regarding the characteristics of their national influenza surveillance system. Results: Twenty-six countries (accounting for over one third of world’s population) joined GIBS Results (Table): seven in the Northern hemisphere, five in the Southern fourteen the inter- population) joined GIBS (Table): seven Results: Twenty-six countries (accounting for hemisphere, over oneandthird of inworld’s intropical the Northern hemisphere, five in the Southern hemisphere, and in the inter- tropical belt. The GIBS belt. The GIBS database includes 935,673 influenza cases collected between 2000 andfourteen 2013, database includes 935,673 influenza between andwere 2013, of which 178,206 (19.0%) were cases of which 178,206 (19.0%) were cases of influenzacases B. Thecollected proportion of influenza A2000 cases that of influenza B. The proportion of influenza A cases that were subtyped was 65.1% and information on strains was subtyped was 65.1% and information on strains was available for 17.2% of influenza B cases. available for 17.2% of influenza B cases. Information on age was available for 59.1% of influenza B cases and 47.6% on age was available for 59.1% of influenza B cases and 47.6% of influenza A cases. ofInformation influenza A cases. Table. Countries participating in the Global Influenza B Study Table. Countries participating in the Global Influenza B Study (GIBS), May 2014 (GIBS), May 2014 Region Countries No. influenza cases Influenza A cases Influenza B cases (No., %) (No., %) Southern hemisphere Argentina (Santa Fe), Australia, Chile, New Zealand, South Africa 210,301 176,742 84.0% 33,559 16.0% Intertropical belt Brazil, Cameroon, Costa Rica, El Salvador, Guatemala, Honduras, Indonesia, Ivory Coast, Kenya, Madagascar, Nicaragua, Panama, Singapore, Viet Nam 62,794 48,847 77.8% 13,947 22.2% Northern hemisphere Bhutan, China, England, Italy, Turkey, Ukraine, USA 662,578 531,878 80.3% 130,700 19.7% Total 26 countries 935,673 757,467 81.0% 178,206 19.0% Conclusions Conclusions: Thanks to the participation of a very large number of countries from most regions of the Thanks to the participation of a very large number of countries from most regions of the world, we have built a world, we have built a unique global influenza database as it is case-based, includes age specific data unique global influenza database as it is case-based, includes age specific data (the FluNet database collects (the FluNet database collects aggregated data that is not age specific), and contains nearly 1 million aggregated data that is not age specific), and contains nearly 1 million cases of influenza. The wealth of info that casesbeen of influenza. The wealth of GIBS info that has been collected means GIBS represents valuable has collected means represents a valuable platform thata can be exploited to address influenza research projects that help support prevention policies around the world. platform that canwill be exploited to addressinfluenza influenza research projects that will help support influenza prevention policies around the world. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P32 POSTE R A BSTRAC TS SPA2P09 Possible explanations for why some countries were harder hit by Influenza A(H1N1)pdm09 – a global mortality impact modeling study Morales, Kathleen (1,2); Paget, John (1); Spreeuwenberg, Peter (1) 1: NIVEL, The Netherlands; 2: Sage Analytica, Rockville, MD. USA Background Since the first confirmed death of Influenza A(H1N1)pdm09 in Mexico in April 2009, researchers and public health officials have continued to search for clarity on the global morbidity and mortality impact of Influenza A(H1N1) pdm09 and its associated risk factors in order to improve future pandemic response. The GLaMOR study (Plos Med 2013), found prominent regional mortality variations in 2009 for Influenza A(H1N1)pdm09, with the highest burden in the Americas and the lowest burden in Europe. Our study attempts to identify factors that explain why the pandemic mortality burden was high in some countries and low in others. Methods As a starting point, we identified possible risk factors worth investigating for Influenza A(H1N1)pdm09 mortality through a targeted literature search. We then used Rubin’s Causal Inference Model to identify factors that could explain differences in respiratory mortality due to Influenza A(H1N1)pdm09 and to determine their impact. We ran Netherlands Institute for Health Services research (NIVEL), Utrecht, The Netherlands Sage Analytica, Rockville, MD. USA sixteen different Causal Inference Models to produce robust results and draw conclusions. In order to assess the role of each factor in explaining differences in excess pandemic mortality, we calculated the mean proportion of pandemic mortality country variance that can be explained by each factor Results The literature search identified 124 publications and 47 possible risk factors. Of the 47 possible risk factors, we identified appropriate global datasets for 27 factors based on four selection criteria (e.g. we could identify enough data from one global source for at least 50 countries). The Causal Inference Models indicated that age structure (explaining 40% of the mean proportion of pandemic mortality country variance), latitude (8%), influenza A and B viruses circulating during the pandemic (3-8%), influenza A and B viruses circulating during the preceding influenza season (2-6%), air pollution (pm10; 4%) and the prevalence of other infections (HIV and TB) (4-6%) were factors that explained differences in mortality around the world. Healthcare expenditure, levels of obesity and air travel did not explain global pandemic mortality differences Conclusions Our study found that countries with a large proportion of young persons and those located in the inter-tropical belt had higher pandemic mortality rates in 2009. These results are difficult to interpret as age is associated with a number of factors (e.g. living in the tropics and HIV) and latitude could be driven by the low mortality rates in the WHO Euro and Western Pacific regions. Interestingly, the co-circulation of influenza viruses during the pandemic and the circulation of influenza viruses during the preceding season were also associated with pandemic mortality rates. Our findings suggest that public health officials confronted with a future pandemic should probably target pandemic preparedness activities in the young and in countries with high rates of HIV/TB. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P33 POSTE R A BSTRAC TS SPA2P10 Evolution of highly pathogenic avian influenza (H5N1) virus of domestic poultry in Vietnam between 2011 and 2013 Lee, Eun-Kyoung (1); Kang, Hyun-Mi (1); Song, Byung-Min (1); Jeung, Jipseol (1); Choi, Jun-Gu (1); Thanh, Long To (2); Tho, Dang Nguyen (2); Choi, Kang-Seuk (1); Kye, Soo-Jeong (1); Kim, Ji-Ye (1); Lee, Hee-Soo (1); Lee, Youn-Jeong (1) 1: Animal and Plant Quarantine Agency, Korea, Republic of (South Korea); 2: National Center for Veterinary Diagnosis, Department of Animal Health, Vietnam Background Since the H5N1 highly pathogenic avian influenza (HPAI) virus was first detected in 1996 in southern china, the virus has spread to more than 60 countries across Asia, the Middle East, Europe and Africa. With a threat to public health, H5N1 has caused major losses in poultry flocks in affected areas through either direct infection or preventive culling. In spite of vaccination campaigns, H5N1 viruses continue to circulate in Vietnam for domestic poultry. To estimate the prevalence of AIV in Vietnam, surveillance was conducted between November 2011 and Feburary 2013. Methods A total of 450 samples, collected in 54 provinces of Vietnam, were obtained from the National Center of Veterinary Diagnostics of Vietnam (NCVD). After initial screening for Matrix gene of AIV using real-time RT-PCR, AIV positive samples were inoculated into embryonated eggs for virus isolation. For subtyping of AIV, Hemagglutination (HA) and Neuraminidase (NA) gene of all AIV isolates were amplified with gene-specific primers (Hoffmann, et al., 2001) using the One-Step RT- PCR kit (Qiagen, USA) and confirmed by sequencing analysis, which were identified by BLAST searches of the National Center for Biotechnology Information (NCBI) database. To analyze the phylogenetic analysise of the Vietnamese H5 subtype AIVs in this study, of all isolates, 31 AIVs for Surface genes and 17 AIVs for internal genes were selected according to the HA clades, region and prevalence. Results We report on the genetic analysis of 311 HPAI H5 viruses isolated from poultry in Vietnam and investigated possible genetic relationships with neighboring countries. Two H5N1 HPAI clades were circulating in the Southern provinces (clade 1.1) and Northern provinces (clade 2.3.2.1) of Vietnam. Phylogenetic analysis of the H5 AIVs revealed clade 1.1 is geographical circumscribed group related with Cambodia and subclade 2.3.2.1C were emerged in June 2012 and was predominat in 2013 in Northern and Central province. In the NA gene tree, most of H5N1 isolates can be divided into major two groups and HA clade groups shared also NA lineages. In gene constellation, Clade 2.3.2.1C viruses were found to be reassortants between Clade 2.3.2.1A(PB2, PA) and new subtype of Clade 2.3.2.1B(PB1, NP, NA, M, NS). Interestingly, Enzootic vietnamese clade 2.3.2.1C H5 virus subsequently reassorted with N2 originated from wild bird to generated H5N2 HPAI, which isolated from duck in live bird market(LBM). Conclusions The results of the present study revealed that HPAI H5N1 viruses are endemic in Vietnam. Vietnamese viruses have genetic diversity depend on regions and the genetic subclade have been changed. Recently Evolution and genetic reassortment events of Clade 2.3.2.1 were identified from phylogenetic analysis. Further investigation of inter-country surveillance programs are required if we are to understand the epidemiology of these viruses and to manage the emergence of novel types. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P34 POSTE R A BSTRAC TS SPA2P11 ANALYSIS OF INFLUENZA SENTINEL SURVEILLANCE RESULTS IN KAZAKHSTAN, 2013-2014 EPIDEMIOLOGICAL SEASON Ozhanova, Alfiya Ibiraimovna; Mirzabekova, Gulfairuz Kuralbekovna Zhambyl oblast Consumers Rights Protection Department of of Consumers Rights Protection Agency of Kazakhstan Republic, Kazakhstan Introduction Since 2008, the practice of year-round sentinel surveillance (SS) for influenza- like illnesses (ILI) and severe acute respiratory infections (SARI) was adopted in the Republic of Kazakhstan to complement the routine surveillance for acute respiratory infections (ARI) and influenza. During the last epidemiological season of 2013-2014, SS included 22 hospitals and 24 clinics in 7 cities. Following WHO recommendations, in 2011 the epidemiology of ILI and SARI sentinel surveillance was strengthened and today all persons with ILI and persons admitted to hospital with SARI are included into the overall statistics. We determined the characteristics of the 2013-2014 influenza season. Methods Data in the online database, as well weekly data collected by the routine surveillance for ARI and influenza epidemiological season, were reviewed. Results In the 2013-2014 epidemiological season, the ILI incidence rate was 400 cases per 100,000 population. The highest ILI incidence was observed during the 7th through the 12th weeks of 2014, being highest among children under 5, ranging between 81.3 to 108.9 cases per 100,000. The lowest ILI incidence rate occurred among people above 65 years of age, ranging between 5.2 to 7.6 cases per 100,000. The percentage of PCR-positive influenza tests among ILI patients was 25.6% (140/545). Influenza virus circulated among ILI patients during the 45th through the 16th week, with the largest number of PCR+ influenza cases occurring during weeks 7-9 (55%, 59% and 58%, respectively). Of the 140 confirmed influenza cases, the proportion of influenza virus type A comprised 96.4%, type B – 3.6%. Both influenza virus A subtypes, A/H1N1-09 – 45.9% and A/H3N2 – 54.1%, circulated concomitantly. SARI incidence in the 2013-2014 season was as high as 247.5 per 1,000 admissions to sentinel hospitals. The highest SARI incidence was from week 44 through the week 50 (ranging 294-327 per 1,000 admissions) due to other respiratory pathogens, because SARI patients began to test positive for influenza from week 50. Influenza circulation among SARI patients was observed from week 49 to week 16. High SARI rates were registered mainly among children under 5 throughout the season, ranging from 100 to 319 per 1,000 admissions. The proportion of PCR-positive tests among SARI patients was 30.4% (271/891), mainly driven by influenza type A – 99.6% (270/271) and only one case of influenza type B (0.4 %). The A/H1N1-09 influenza subtype was found in 47% (127/270) and A/H3N2 in 53% of all cases (143/270). Conclusions The 2013-2014 epidemiological season saw an active circulation of influenza type A, and only a few isolated cases of influenza type B in ILI and SARI patients. There was concomitant circulation of influenza A subtypes A/H1N1-09 and A/H3N2. A high incidence of ILI and SARI was recoded in children under 5 years of age. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P35 POSTE R A BSTRAC TS SPA2P12 SOME APPROACHES TO PREDICTION OF SEASONAL INFLUENZA EPIDEMIC BURDEN Sominina, Anna A.; Karpova, Ludmila; Smorodintseva, Elizaveta; Grudinin, Mikhail; Pisareva, Maria; Komissarov, Andrei; Eropkin, Mikhail; Konovalova, Nadejda; Danilenko, Daria Research Institute of Influenza, Russian Federation Background New knowledge on annual influenza activity and correlations with peculiarities of influenza virus type/sub-type circulation in Russia are helpful for prediction of epidemic impact on country level and for understanding of the spread of epidemics and future pandemic on a global level. Goal of this investigation was complex analysis of routine and sentinel epidemiological data, antigenic and genetic peculiarities of viruses circulated in Russia for the 5 years period since the emerging of new pandemic influenza virus in 2009. Methods Results of routine epidemiological surveillance based on investigation of WHO NIC of Russia in collaboration with regional base laboratories. The methods used were described earlier (A.A.Sominina at al., AJID, 9(3):77-93, 2013) Results Enhanced epidemiology capacity and infrastructure for disease surveillance with weekly analysis of ILI and ARI morbidity by age groups both for early recognition of epidemic start and for evaluation of epidemic intensity, geography spread and hospitalization rates achieved last years in Russia. Three influenza season 2009-2010, 20102011 and 2012-2013 associated with domination of influenza A(H1N1)pdm09 virus characterized with the highest morbidity, hospitalization and lethality index in the European part of Russia. At that influenza A(H3N2) circulated simultaneously in Far East and Siberian regions having close relations with Japan and China, correspondingly. Majority of influenza associated death cases in Russia was caused by virus subtype A(H1N1)pdm09. During 20112012 and 2013-2014 seasons influenza activity caused mainly by subtype A(H3N2) was moderate or low. Data of sentinel surveillance indicated that SARI cases were registered mainly among not vaccinated patients. Main risk factors for SARI was pregnancy, chronic cardiovascular and lung diseases and diabetes. No pronounced changes were observed in antigenic properties both of circulated influenza A(H1N1)pdm09 viruses closely related to influenza A/California/07/09 virus and influenza A(H3N2) viruses antigenically related to reference viruses A/Victoria/361/11 and A/Texas/50/12. Influenza A(H1N1)pdm09 viruses genetically belonged to phylogenetic group 6 (A/St.Petersburg/27/2011-like strains) and A(H3N2) viruses belonged to A/Victoria/361/2011like clade (group 3C.3). Decrease of intensity of influenza A(H1N1)pdm09 activity from year to year was associated apparently with increase of population immunity level to this virus registered during last years. Influenza B activity during analyzed period was less significant. Both viruses of Victorian (B/Brisbane/60/08-like) and Yamagata (B/ Massachusetts/02/12 or B/Wisconsin/01/2010-like) lineage were isolated in different proportions during these five seasons. Conclusions Enhanced integration of laboratory and epidemiologic surveillance for influenza make it possible to recognize increase of influenza activity and epidemic start, determine etiology and anticipated severity of upcoming epidemic. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P36 POSTE R A BSTRAC TS SPA2P13 Influenza surveillance systems in Europe – a recent survey update Meerhoff, Tamara (1); Vermaire, Jorien (2); Jorgensen, Pernille (2); Gross, Diane (2); Pereyaslov, Dmitriy (2); Brown, Caroline (2) 1: Radboud university medical center, Department of Primary and Community Care, Nijmegen, the Netherlands; 2: WHO Regional Office for Europe, Denmark Background Influenza surveillance plays an important role in determining appropriate control and intervention measures and informing case management recommendations by providing timely data on virological and epidemiological indicators for influenza. In Europe, a regional influenza surveillance network is coordinated by the World Health Organization (WHO) Regional Office for Europe and the European Center for Disease Prevention and Control (ECDC). Combined clinical and virological data are collected by primary care facilities from patients with influenza-like illness (ILI) and/or acute respiratory infections (ARI). Since the emergence of influenza A(H1N1)pdm09 in 2009, countries have established hospital-based surveillance for influenza. Little is known about the current case definitions and surveillance methods used, this information is essential to interpret and compare data across Europe and to further improve surveillance. In 2001, a survey on the surveillance systems in 21 countries in Europe was carried out. At present, influenza surveillance data are available for 50 Member states. The purpose of this study was to provide an updated review on current surveillance systems in the WHO European Region. Methods WHO Regional Office for Europe and ECDC conducted an email survey in March 2014. The survey included questions on the presence of primary care, hospital and other types of surveillance, case definitions, laboratory testing and epidemiological data collected in each of these systems. Results 47 out of 50 Member States completed the survey. All countries perform primary care surveillance and 31 countries perform hospital-based surveillance. Practically all countries report data from primary care sources while for severe disease surveillance only 48% of the countries report data to the European network. Sentinel systems reporting ILI/ ARI are primarily used and sentinel doctors generally cover 1-15% of the population. The majority of countries use the WHO or the European Union (EU) case definition for ILI (73%) or ARI (64%). For severe acute respiratory infection surveillance 51% use the WHO case definition. Generally a standard protocol is used when taking respiratory specimens and patient details are collected routinely. However, data on onset of illness, underlying conditions and/ or outcome of the disease are collected by less than 60% of the countries. Conclusions This survey provides insight in current influenza surveillance systems in the WHO European Region and has identified strengths and weaknesses in the data collection. Practically all countries that collect primary care surveillance data report to the European network, while half of countries that have hospital-based surveillance are reporting these data. The data collection on onset of illness, underling diseases and outcome can be improved. The results will be used to further strengthen the quality of data collected, to help interpret the surveillance data and will lead to appropriate control and intervention measures that need to be taken in an epidemic. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P37 POSTE R A BSTRAC TS SPA2P14 Transmission of the human influenza virus A/NL/602/09, but not the triple reassortant A/swine/Kansas/77778/07, occurs efficiently from low infectious dose in guinea pigs Campbell, Patricia J. (1); Danzy, Shamika (1); Ramos, Irene (2); Fernandez-Sesma, Ana (2); Lowen, Anice C. (1); Steel, John (1) 1: Emory University, United States of America; 2: Mount Sinai School of Medicine, United States of America Background Swine influenza viruses of the triple reassortant (TRIG) lineage do not transmit efficiently among humans. Nonetheless, this virus lineage donated 6 of the 8 gene segments present in the highly transmissible 2009 pandemic influenza virus. Neither the genetic determinants nor the mechanistic bases responsible for the difference in transmissibility are fully delineated. We have previously shown that the guinea pig model broadly recapitulates the differences in transmissibility between swine and human strains of influenza virus, using inoculation doses of ~10 000 PFU per animal. In the present study, we reasoned that an influenza virus with optimal fitness at a population level should exhibit both a low median infectious dose and the ability to transmit rapidly to a new host following infection at the minimal infectious dose. Toward understanding their differing potentials for spread in the human population, we applied this concept to influenza A/swine/Kansas/77778/07 (H1N1) [KAN07] and A/NL/602/09 (H1N1) [NL602] viruses. Methods Utilizing plasmid-based reverse genetics, we generated recombinant NL602 and KAN07 viruses. Specific reassortant viruses containing segments from two backgrounds were also generated. Growth phenotypes were assayed in vitro in MDCK and HTBE cells, and infectivity, replication and transmission were assessed using a guinea pig contact transmission model. Receptor binding preferences of each virus were assessed using a solid phase binding assay as well as a flow cytometry based assay utilizing labelled sialic acid analogues. Results We show that NL602 virus possesses a lower 50% infectious dose than KAN07 in the guinea pig model (GPID50 = 3.16 PFU for NL602 versus 213.8 PFU for KAN07). Moreover, when donor animals were inoculated with a minimal infectious dose, NL602 virus transmitted from each infected animal to a naïve contact, whereas KAN07 virus transmitted only from animals receiving higher initial doses. In groups of guinea pigs inoculated with approximately 100, 10 or 1 GPID50 of NL602 virus, 100% transmission from infected animals to cagemates was observed. In animals inoculated with ≤100 GPID50 of KAN07 virus, no greater than 50% transmission efficiency was seen. Using recombinant viruses possessing reassortant genotypes of NL602 and KAN07, we mapped the observed phenotypes to the HA and NA segments of NL602 virus. Preliminary receptor binding studies indicate that NL602 virus possesses alpha 2,6- linked sialic acid receptor specificity only, whereas KAN07 possesses both alpha 2,3- and alpha 2,6-linked sialic acid binding. Studies are underway to test the importance of this difference to infectious dose and transmissibility. Conclusions Unlike KAN07, the human influenza virus strain NL602 infects guinea pigs from low dose inoculation, and transmits onwards efficiently to contact animals. We speculate that low infectious dose and the ability to transmit rapidly from low dose are key characteristics distinguishing human viruses from viruses capable of zoonotic infection of humans. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P38 POSTE R A BSTRAC TS SPA2P15 Influenza surveillance in the Netherlands: a new system covering 5% of the population that uses Electronic Medical Records Hooiveld, Mariëtte (1); Donker, Gé (1); Meijer, Adam (2); Zock, Jan-Paul (1); Schellevis, François (1) 1: NIVEL, Netherlands institute for health services research, Utrecht, the Netherlands; 2: National Institute for Public Health and the Environment (RIVM), Bilthoven, the Netherlands Background The surveillance of influenza is important to monitor the spread and impact of the disease and to detect the emergence of new viruses. Traditional surveillance systems have been based on reporting by sentinel General Practitioners (GPs) and laboratory testing. With electronic medical records, automatic data collection of routinely recorded information from health care providers is possible. In the Netherlands, a new syndromic surveillance system has recently been established to complement the existing sentinel influenza-like illness (ILI) surveillance system. Methods Daily information on morbidity is automatically collected once a week from 250 general practices, participating in NIVEL Primary Care Database. Every Dutch citizen is obligatory enlisted in a general practice and the GP acts as a gatekeeper for specialized, secondary health care. The electronic medical records kept by the GP, therefore, provide the most complete picture of the population’s health. In addition, some 40 practices within NIVEL Primary Care Database report patients with clinically diagnosed ILI (Sentinel General Practices, since 1970) and take nose- and throat swabs for virological analyses (since 1992). Results In total, the syndromic surveillance system covers a population of 1 million people, about 5% of the Dutch population. The larger population allows for stratification by smaller groups or for instance in areas with a high density of poultry. Weekly numbers on patients consulting for an Acute Respiratory Infection (ARI, including ILI) or pneumonia are published on the NIVEL website. Although ARI is less specific for an influenza virus infection than ILI, seasonal data are highly correlated. The weekly number of patients consulting the GP for ARI or pneumonia were lower during season 2013/2014 compared to previous seasons. A mild ILI-epidemic was observed during weeks 2 to 16, with ILI incidences around the baseline threshold and influenza virus detection in 0 to 50% of the ILI specimens collected per week. Rhinovirus and respiratory syncytial virus explained a relatively large part of the ILI incidence. Conclusions The new syndromic surveillance system complements the traditional sentinel surveillance of influenza-like illness in the Netherlands. Integration of the two systems provides more detailed information on patients with ARI and likely influenza, and the power of a large-scale network. There are plans to make the ARI data from this new surveillance system available to ECDC/WHO Euro and the global surveillance system WHO FluID. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P39 POSTE R A BSTRAC TS SPB2: VIRAL FACTORS IN PATHOGENESIS SPB2P01 Relative role of individual complement pathway during influenza infection Rattan, Ajitanuj National Center For Cell Sciences (NCCS), India SPB2P02 Flt3 signaling is critical for host response after influenza A infection Kühn, Nora (1); Hatesuer, Bastian (1); Dengler, Leonie (1); Wilk, Esther (1); Schäkel, Friederike (1); Pils, Marina (2); Beutler, Bruce (3); Schughart, Klaus (1) 1: Department of Infection Genetics, Helmholtz Centre for Infection Research, University of Veterinary Medicine Hannover, and University of Tennessee Health Science Center, 38124 Braunschweig, Germany; 2: Mousepathology, Helmholtz Centre for Infection Research, 38124 Braunschweig, Germany; 3: Center for Genetics of Host Defense, University of Texas Southwestern Medical Center, Dallas, Texas, USA FMS-like tyrosine kinase 3 (Flt3) is a hematopoietic receptor tyrosine kinase important for the development of many immune cells including dendritic cells (DC) and natural killer (NK) cells. Binding of its ligand Flt3l results in stimulation of the growth of progenitor cells in the bone marrow and blood. The Flt3wmfl/wmfl (warmflash – wmfl) strain was identified in an ENU (N-ethyl-N- nitrosourea) mutagenesis screen for susceptibility to mouse cytomegalovirus (MCMV). The induced point mutation (G to A) causes a shift of the splice donor site and an in-frame deletion of two amino acids in Flt3. Here, we studied the host response to influenza A infections in Flt3wmfl/wmfl mice. Flt3wmfl/wmfl mice are smaller than wild type of same age and sex. Furthermore they exhibit an abnormal loss of hair and show increased urination. Flow cytometry analysis of lung cell populations indicates a decreased CD11chigh MHCIIhigh subpopulation representing alveolar DCs in uninfected Flt3wmfl/wmfl lungs. Additionally a reduced NKp46+ cell population (NK cells) was found compared to wild type mice. Also, mutant mice exhibit lower numbers of CD11c+ MHCII+ cells in the draining lymph nodes (dLN). Flt3wmfl/wmfl mutants showed an increased susceptibility to influenza A virus infection compared to wild type mice. After infection with a low virulent H1N1 PR8M virus, Flt3wmfl/wmfl mice lost weight rapidly and died 6 to 8 days post infection. In contrast, the wild type controls regained body weight after day 7 and survived. At days 1 to 5 after infection, Flt3wmfl/wmfl mice exhibit a similar viral load in the lungs as wild type mice. Flt3wmfl/wmfl mice respond to influenza A infection with a higher granulocyte count in peripheral blood compared to wild type. The immune cell infiltration in the lung is currently under investigation. In summary, the absence of Flt3 signaling in mice results in high susceptibility to influenza A infections. We hypothesize that a defect in the link between innate and adaptive immune response due to reduced numbers of DCs and NK cells in Flt3wmfl/wmfl mice might be responsible for this increased susceptibility to influenza virus infection. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P40 POSTE R A BSTRAC TS SPB2P03 H7N9 and H6N1 influenza A virus hemagglutinins engineered to bind human type receptors reveal a novel layer of specificity beyond the α2-6 linkage of sialic acid de Vries, Robert P; Peng, Wenjie; McBride, Ryan; Paulson, James C The Scripps Research Institute, United States of America Influenza A virus (IAV) is a serious pathogen in livestock and humans. The virus resides in the wild waterfowl population but is able to cross the species barrier to various mammals. One part of this barrier is the recognition of sialic acid receptors. Avian viruses prefer binding to sialic acid with an α2-3 linkage to the penultimate galactose (avian type), whereas human viruses bind to sialic acid with an α2-6 linkage (human type). All previous human pandemics were of avian or swine origin and were accompanied by amino acid mutations in HA that shifted binding from avian to human type. With the continuous threat of avian viruses, H5N1, H6N1, H7N9 and H10N8, infecting humans that if adapted to bind human type receptors, could spark another pandemic, it is vital to know which amino acid changes are required in these subtypes for this specificity shift. Several assays have been developed to assess receptor-binding specificity of IAVs, all have some drawbacks such as being only qualitative, using only terminal parts of more complex glycans, but most importantly lacking the representation of biological relevant glycans found in the human lung. Recently it has been reported that the glycome of human respiratory tissues contain highly complex N-linked glycans containing multiple Galβ1-4GlcNAc (LacNAc) repeats on their antennae. To represent these glycans on our glycan-arrays we created a series of bi- and tri-antennary N- linked glycans with 2 to 5 LacNAc repeats by chemo-enzymatic synthesis. These structures were sialylated with either α2-3 or α2-6 linked sialic acid and printed on a glycan-array and then probed with human and avian recombinant hemagglutinins (HA). Although the paradigm of avian viruses binding to α2-3 and human viruses binding to α2-6 linked sialic acids was maintained. Exemplified by human H7N9 and H6N1 viruses, not yet adapted to human type receptors, that bound to avian type receptors. However when selective mutations were introduced in the conserved binding pocket, we were able to create H7 and H6 HAs that specifically bound to human type receptors. Inspection of the glycans bound revealed another layer of specificity towards complex N-linked glycans bearing 3 to 5 LacNAc repeats. These glycans were very similar to those bound by the human 2009 pandemic Cal/04/09 HA. Cal/04/09 did not bound to any glycan arrays before, as previous arrays did not contain these highly complex structures, but perhaps more importantly, Cal/04/09 transmits highly efficient by respiratory droplets between ferrets and humans. We hypothesize that the arms of these N-linked glycan can bind to two monomers within the HA trimer, furthermore we are currently exploring the biological consequences of binding these highly complex structures by engineered H7N9 and H6N1 viruses. (Supported by NIH Grant AI099275 and a Rubicon Grant of the Netherlands organization for scientific research (to RPdV). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P41 POSTE R A BSTRAC TS SPB2P04 Activation of coagulation and tissue fibrin deposition in experimental influenza in ferrets Goeijenbier, Marco (1); van Gorp, Eric C.M. (1); van den Brand, Judith (1); Stittelaar, Koert (2); Bakthiari, Kamran (2); Roelofs, Joris T.H. (2); van Amerongen, Geert (1); Kuiken, Thijs (1); Martina, Byron (1); Meijers, Joost C.M. (3); Osterhaus, Albert D.M.E. (1) 1: ErasmusMC, Netherlands, The; 2: Viroclinics, Netherlands, The; 3: Academic Medical Center, Netherlands, The Background Epidemiological studies relate influenza infection with vascular diseases including myocardial infarction. In several animal model studies the procoagulant effects of influenza virus infection have been investigated. Since these studies made use of animals only susceptible to laboratory animal adapted influenza viruses, their results are hard to translate to human influenza. Therefore we decided to study the influence of different human influenza virus infections on coagulation in the ferret influenza model. Methods Ferrets were infected with either a seasonal-, pandemic- or highly pathogenic avian influenza (HPAI-H5N1) virus strains, or mock,infected. In a 14 day interval (only 4 days for HPAI-H5N1) with in total 7 time points, 4 animals were euthanized per timepoint and citrated plasma was tested for prothrombin time (PT), activated partial thromboplastin time (aPTT), Von Willebrand factor activity (VWF), thrombin-antithrombin complex levels and D-dimer. Lung tissue was used for fibrin staining. Results All influenza virus infected animals showed alterations in hemostasis. Specifically on day 4 post infection, a four second rise in both PT and aPTT was observed. D-dimer concentrations increased in all 3 influenza groups with the highest concentrations in the pandemic influenza group. Von Willebrand factor activity levels increased early in infection suggesting endothelial cell activation. Mean thrombin-antithrombin complex levels increased in both pandemic and HPAI-H5N1 virus infected ferrets. At tissue level, fibrin staining showed intracapillary fibrin deposition especially in HPAI-H5N1 virus infected ferrets. Discussion This study showed hemostatic alterations both at the circulatory and at the tissue level upon infection with different influenza viruses in an animal model closely mimicking human influenza virus infection. Alterations largely correlated with the severity of the respective influenza virus infections. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P42 POSTE R A BSTRAC TS SPB2P05 Analysis of the host response to influenza A virus infection in the Collaborative Cross founder strains Leist, Sarah R. (1); Pilzner, Carolin (1); Kollmus, Heike (1); Schughart, Klaus (1,2,3) 1: Helmholtz Centre for Infection Research, Germany; 2: University of Veterinary Medicine Hannover, Germany; 3: University of Tennessee Health Science Center, Memphis, USA Background Influenza A virus poses a major health threat and caused multiple severe pandemics in the last century with millions of death. The course and outcome of an influenza A infection is influenced by viral as well as host factors. We use mouse genetic reference populations (GRPs) to identify genetic host factors that contribute to resistance or susceptibility to influenza A infections. The recently established Collaborative Cross (CC) is a GRP derived from eight genetically different founder strains. Amongst them are classical lab strains (A/J, C57BL/6J, 129S1/SvlmJ) as well as mouse models for human diseases like diabetes (NOD/ShiLtJ) and obesity (NZO/HILtJ). The addition of three wildderived strains (PWK/PhJ, CAST/EiJ and WSB/EiJ) strongly enhances the genetic diversity. These founder strains were bred in a specific breeding funnel to generate 500 – 700 recombinant inbred CC lines. Each of the CC lines represents a unique mosaic of the genetic information of the eight founder strains. Methods Here, we present our analysis of the eight CC founder strains and four CC lines (OR13140, OR13067, IL16188, IL16211) after infection with the mouse-adapted influenza virus strain A/HK/01/68 (H3N2). Female as well as male mice were infected intra-nasally with up to three different concentrations of H3N2. Body weight and survival was monitored for 14 days after infection. In addition, we characterized the host response in more detail by analyzing the hemogram of peripheral blood and determining viral loads in infected lungs. Results We found large differences in the host response between the different CC founder and CC lines. We observed ‘expected’ phenotypes e.g. high viral loads accompanied by a strong increase in immune cell counts in the blood in case of lethal outcomes of infection, but also unexpected phenotype combinations were seen. In general, the lethal or non-lethal outcome of the infection was mainly influenced by the different Mx1 alleles segregating in the CC founder strains. However, we could also show that the function of Mx1 is modulated by the genetic background in one of the four CC lines. Conclusions The genetic diversity present in the CC founder strains is reflected by the different phenotypic outcomes after influenza A infection. Moreover, CC lines exhibit additional phenotypic combinations which are not observed in the eight founder strains. Thus, CC lines represent a valuable resource for genetic mapping studies to unravel novel host factors that influence susceptibility and resistance to influenza A infections. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P43 POSTE R A BSTRAC TS SPB2P06 Type I interferon-mediated signaling is inhibited upon influenza A virus and Staphylococcus aureus co-infection Warnking, Kathrin; Klemm, Carolin; Löffler, Bettina; Niemann, Silke; Peters, Georg; Ludwig, Stephan; Ehrhardt, Christina Westfälische Wilhelms-University Münster, Germany Background Influenza A viruses (IAV) are the causative agents of severe respiratory diseases. The majority of disease fatalities are linked to secondary bacterial pneumonia, caused by pathogens such as Staphylococcus aureus (S. aureus). One major problem of the increased pathogenicity is the dysregulation of the cellular immune response. While this is a well-known complication, there is only scarce knowledge about the interplay of IAV with S. aureus during infection on a molecular level. Thus we assessed the regulation of type I interferon (IFN) response in an IAV/S. aureus coinfection model in vitro. Methods To investigate cellular signal transduction processes in the human lung epithelial cell- line (A549) upon IAV/S. aureus co-infection we established a complex infection procedure. For co-infection various IAV subtypes, the S. aureus strain 6850 and heat killed S. aureus (HKSA) were employed. In control experiments viral RNA, different bacterial factors and IFN beta were used as stimuli. Viral titers were analysed by standard plaque assays. Regulation of pathogeninduced type I IFN-mediated signaling was investigated on mRNA and protein levels via qRT-PCR, Western Blot analysis and co-immunoprecipitation assays. Result By using an in vitro co-infection model of A549 cells, we were able to show that IAV replicate more efficiently in the presence of S. aureus. Investigation of pathogen- induced signaling mechanisms during co-infection surprisingly revealed a stronger induction of the innate immune response, most importantly increased levels of type I IFN mRNA. In disagreement with that, mRNA levels of strictly IFN-stimulated genes, such as MxA or OAS, were rather decreased, correlating with reduced IFN-induced protein expression. Based on these results, we hypothesize that there seems to be a block of type I IFN signaling provoked by the bacteria. In fact, we were able to show that independent of the initial stimulus that drives IFN beta up-regulation, metabolically active intracellular S. aureus inhibits type I IFNmediated STAT1 phosphorylation and subsequently STAT1-STAT2 dimerization. Conclusions In the presence of S. aureus the first line of defence against influenza viruses is interrupted, resulting in a boost of viral replication, which may lead to enhanced pathogenicity. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P44 POSTE R A BSTRAC TS SPB2P07 Lipoteichoic acid of Staphylococcus aureus as main contributor to the enhancement of influenza A virus induced mitogen-activated protein kinase signaling Klemm, Carolin (1); Warnking, Kathrin (1); Löffler, Bettina (2); Peters, Georg (2); Ludwig, Stephan (1); Ehrhardt, Christina (1) 1: Westfaelische Wilhelms-University Muenster, Germany; 2: University Hospital of Muenster, Germany Background Bacterial co-infections are a major complication of influenza A virus (IAV) infections leading to severe illness and fatal outcomes. Recent findings suggest that beside the pathogen load, a dysregulated immune response of the host also contributes to increased morbidity and mortality. Toll-like receptors (TLRs) play an important role in the innate immune response by pathogen sensing and activating signaling cascades leading to the induction of proinflammatory cytokines and chemokines. Although several in vivo studies demonstrate elevated levels of cytokines and chemokines upon IAV and bacterial co-infections resulting in a massive influx of immune cells into the lung and severe tissue damage, the underlying molecular signaling mechanisms still remain to be elucidated. This knowledge is crucial for development of new therapeutic approaches. Methods In this study, we investigated the signaling events upon co-infection of IAV and Staphylococcus aureus (S. aureus) in a human epithelial cell line (A549) in vitro. We established a co-infection protocol including serial pathogen incubation combined with an antibiotic wash. Furthermore we used viral and bacterial components to mimic infection by applying viral RNA or several bacterial factors. Manipulations of different signaling pathways were achieved by siRNA approaches. Phosphorylation and activation of mitogen-activated protein kinases (MAPKs) were investigated by immunoblotting and quantitative Real-Time-PCR was performed to analyse mRNA levels of several cytokines and chemokines. Results Upon co-infection with IAV and S. aureus we observed elevated levels of cytokines and chemokines as described in in vivo models. Analyses of cellular signaling mechanisms regulating these immune responses revealed significantly increased activation of the MAPKs JNK and p38 in presence of both pathogens compared to IAV-infected cells. Similar results were obtained, when IAV infection was replaced with viral RNA or S. aureus infection was restored by lipoteichoic acid (LTA) stimulation, but not with other bacterial components. Conclusions Our data indicate a correlation of hyper-activation of MAPKs and hyper-transcription of pro-inflammatory cytokines and chemokines to the activation of TLRs. We will provide deeper insights in the regulation of pathogenicity during IAV and S. aureus co-infections on a molecular level, which contributes to the lethal synergism of these pathogens. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P45 POSTE R A BSTRAC TS SPB2P08 Pandemic swine-origin H1N1 influenza virus replicates to higher levels and induces more fever and acute inflammatory cytokines in Cynomolgus versus Rhesus monkeys and can replicate in Common Marmosets Mooij, Petra; Koopman, Gerrit; Mortier, Daniella; van Heteren, Melanie; Fagrouch, Zahra; de Laat, Rudy; Remarque, Edmond J.; Kondova, Ivanela; Verschoor, Ernst J.; Bogers, Willy M.J.M. Biomedical Primate Research Centre, Netherlands, The Background Because of the close immunologic and physiologic resemblance with humans, non-human primates have provided valuable models in studying influenza virus pathogenesis, immunity and vaccine efficacy against infection. Although both cynomolgus and rhesus macaques are frequently used in influenza virus research, a direct comparison of susceptibility to infection and disease had not yet been performed. Methods and Results In the current study a recently described swine-origin pandemic H1N1 strain, derived from a single stock and given at the same dose and route of infection, showed in cynomolgus macaques significantly higher levels of virus replication, both in peak level and duration of virus production in the upper airways and in the lungs, as well as higher increases in body temperature relative to rhesus macaques. In contrast, clinical symptoms including respiratory distress were easier observable in rhesus macaques. The study also shows that common marmosets, a new world non-human primate species, are susceptible to infection with pandemic H1N1. Conclusions The study results favour the cynomolgus macaque as model for influenza virus research because of the more uniform and high levels of virus replication as well as temperature increases. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P46 POSTE R A BSTRAC TS SPB2P09 Insights into the interaction of influenza A virus RNA polymerase with cellular RNA polymerase II Martínez-Alonso, Mónica; Hengrung, Narin; Vreede, Frank; Fodor, Ervin Sir William Dunn School of Pathology, University of Oxford, United Kingdom Background The influenza virus RNA polymerase is known to interact with the carboxy-terminal domain (CTD) of cellular RNA polymerase II (Pol II) but the molecular details of this interaction and its biological role remain uncharacterised. Whether influenza virus polymerase binds directly to the CTD of Pol II or if this interaction is mediated by host factors remains controversial. In addition, it is unclear if the binding occurs between Pol II and free polymerase or polymerase that is part of vRNPs. This study addresses these questions under the hypothesis that direct binding to Pol II would facilitate cap-snatching for viral transcription. Methods HEK 293T cells were infected with influenza A/WSN/33 virus and subjected to RNA immunoprecipitation (RIP) to analyse the presence of viral RNAs in Pol II complexes. Infected cell lysates were also subjected to peptide pulldowns using synthetic peptides consisting of four repeats of the consensus sequence of Pol II CTD (YSPTSPS) with modifications to represent different phosphorylation states. The set of peptides was also used to analyse in vitro binding of purified viral polymerase. For these experiments, the viral polymerase was either purified from HEK 293T cells coexpressing a short vRNA template, or expressed in insect cells and bound to synthetic RNA oligonucleotides mimicking the vRNA promoter. The presence of RNA in the peptide-bound complexes was analysed by radiolabelling and the activity of the peptide-bound polymerase was assessed by an in vitro transcription assay. Results Viral RNAs coimmunoprecipitated with Pol II complexes, suggesting that the viral polymerase that interacts with Pol II is assembled into vRNPs. In addition, vRNPs were also pulled down from infected cell lysates with a Pol II CTD mimic peptide phosphorylated on serine 5. This phosphorylation state mimics the form of Pol II engaged in transcription initiation. Recombinant viral polymerase also bound specifically to the serine 5 phosphorylated CTD mimic peptide, and RNA was also present in the bound complexes. Peptide-bound viral polymerase was shown to be able to perform transcription in vitro. Conclusions Our data suggest a model in which vRNPs bind directly via the viral polymerase to Pol II in a transcriptional context, a scenario that could facilitate cap-snatching for viral transcription. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P47 POSTE R A BSTRAC TS SPB2P10 High basal expression of interferon-stimulated genes in transformed human bronchial epithelial (BEAS-2B) cells contributes to influenza A virus resistance Seng, Lai-Giea; Daly, Janet; Chang, Kin-Chow; Kuchipudi, Suresh University of Nottingham, United Kingdom Background Influenza A viruses (IAV) continue to threaten human and animal health globally. Respiratory epithelial cells play a key role in IAV pathogenesis and host innate response. Transformed human respiratory cell lines are widely used in the study of virus-host interactions due to their relative convenience, and the inherent technical limitations of working with primary cells. Transformed cells, however, may have altered susceptibility to virus infection. Proper assessments of different respiratory cell types in their responses to IAV infection are therefore needed to ensure that the cell line chosen will provide results that are of relevance in vivo. Methods Replication kinetics of avian H2N3 (A/mallard duck/England/7277/06) and human H1N1 (A/USSR/77) IAVs were compared between normal primary human bronchial epithelial (NHBE) cells and two commonly used transformed human respiratory epithelial (BEAS-2B and A549) cells. Influenza virus receptor distribution was analysed using sialic acid linkage- specific lectins. IAV replication was assessed by Western blotting of viral matrix and PB1 proteins, and by infectious progeny virus production assays. Host antiviral gene expression was quantified by reverse transcription real time-PCR (qRT-PCR). Results IAV replication was distinctly poor in BEAS-2B cells in comparison with Madin-Darby canine kidney (MDCK), NHBE and A549 cells. BEAS-2B cells co-expressed both human and avian influenza virus receptors indicating that resistance to IAV replication was not due to the absence of influenza receptors. IAV resistance in BEAS-2B cells was accompanied by an activated antiviral state with high basal expression of interferon (IFN) regulatory factor-7 (IRF-7), stimulator of IFN genes (STING) and IFN stimulated genes (ISGs). Pre-treatment of BEAS-2B cells with a pan-Janusactivated-kinase (JAK) inhibitor (pyridine 6) led to increased IAV replication and marked reduction of ISGs. Conclusions BEAS-2B cells are not typical human respiratory epithelial cells in that this cell line is highly resistant to influenza A virus infection, in part due to high constitutive expression of anti-viral ISGs. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P48 POSTE R A BSTRAC TS SPB2P11 The olfactory nerve: A shortcut for influenza viruses into the CNS in humans !? van Riel, Debby (1); Leijten, Lonneke M. (1); Verdijk, Rob M. (2); GeurtsvanKessel, Corine (1); van der Vries, Erhard (1); van Rossum, Annemarie M.C. (3); Osterhaus, Albert. D.M.E. (1); Kuiken, Thijs (1) 1: Erasmus MC, Department of Viroscience, The Netherlands; 2: Erasmus MC, Department Pathology, The Netherlands; 3: Erasmus MCSophia,Department of Paediatric Infectious Diseases and Immunology, The Netherlands Background Influenza virus associated CNS disease is the most common extra-respiratory tract complication of influenza in humans. The pathogenesis of influenza virus-associated CNS disease, including the route of entry is largely unknown. Recently we have shown that in ferrets highly pathogenic H5N1 virus is able to enter the CNS via the olfactory nerve, causing a severe meningo- encephalitis. The olfactory nerve directly connects the nasal cavity with the CNS and could therefore function as a shortcut into the CNS. Here, we report on a human case in which we found strong evidence for CNS invasion via the olfactory nerve. Methods From a severely immunocompromised child, who died 3 days after being tested positive for influenza, samples were collected during an extensive autopsy. These samples as well as previous samples collected for diagnostic purposes were tested for the presence of influenza virus RNA and antigen. Subsequently, we determined for human (H3N2 & H1N1) and avian influenza viruses (H5N1) (1) the attachment pattern to normal human and ferret olfactory mucosa and (2) the infection efficiency in differentiated human neuronal cells. Results Influenza virus antigen could only be detected in neurons and glial cells of the olfactory bulb, olfactory tract, and gyrus rectus, which is adjacent to the olfactory bulb. Virus RNA isolated from the olfactory bulb and broncho-alveolar lavage fluid revealed the presence of an H3N2 virus. Virus antigen or RNA could not be detected in any other organs or a serum sample. Virus attachment studies showed that both human and avian viruses attached to the apical side of the human olfactory mucosa. Infection studies revealed that human differentiated neuronal cells could be infected with both human and avian viruses. Conclusions The detection of virus antigen and RNA in the olfactory bulb, together with the absence of virus antigen or RNA in any other organ or serum, suggests that virus entered the CNS via the olfactory nerve in this case. This finding is supported by the ability of H3N2 viruses to attach to olfactory mucosa and to infect human neuronal cells. Virus entry via the olfactory nerve might be an important route of entry into the CNS, even during mild upper respiratory tract disease, which might lead to subclinical to severe disease. To obtain more insight into the frequency and clinical impact of CNS invasion via the olfactory nerve, we emphasize that in any autopsy case involving influenza, the olfactory tract should be examined for evidence of local virus replication. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P49 POSTE R A BSTRAC TS SPB2P12 Experimental co-infection of chickens with lentogenic, mesogenic and velogenic strains of Newcastle disease viruses and highly pathogenic avian influenza viruses Pantin-Jackwood, Mary Josephine; Costa-Hurtado, Mar; Afonso, Claudio; Miller, Patti; Shepherd, Eric; Smith, Diane Southeast Poultry Research Laboratory. USDA, United States of America Background Avian influenza virus (AIV) and Newcastle disease virus (NDV) are two of the most economically important viruses affecting poultry worldwide. Co-infections of poultry with AIV and NDV are a problem from the clinical point of view and diagnosis of these viruses, but little is known on the interactions between these two viruses when infecting birds. AIV and NDV can produce from mild to moderate upper respiratory diseases in their low pathogenic forms [lentogenic or mesogenic NDV and low pathogenicity (LP) AIV], to severe systemic diseases with high mortality in their more virulent forms [velogenic NDV and highly pathogenic (HP) AIV]. Exposure to NDV, either live vaccines or field strains, is nearly unavoidable for commercial and non-commercial poultry worldwide and co-infections with AIV are known to occur. The objective of this study was to determine if co-infection of chickens with different strains of NDV could affect the outcome of infection with HPAI viruses. Methods We conducted three experiments in which we infected chickens with lentogenic, mesogenic or velogenic strains of NDV, and high pathogenicity (HP) AIV’s, by giving the viruses simultaneously or sequentially. Pathogenesis (clinical signs, lesions), presence of the viruses in tissues, duration and titer of virus shedding, and seroconversion to both viruses were evaluated. Results We found that previous infection of chickens with mesogenic and velogenic strains of NDV (Pigeon 84 and CA2002 strains), but not a lentogenic NDV strain (LaSota) interfered with replication of a HPAIV (A/Ck/Queretaro/14588-19/95 H5N2) when given at a high titer dose [106.3 50% egg infectious dose (EID50)] 2 days after NDV inoculation; however high mortality was still observed. Interestingly, chickens were refractory to infection, as measured by lack of disease, virus shedding and seroconversion, when given lower titers (105.3 EID50) of the same HPAIV 3 days after the mesogenic NDV (Pigeon 84), indicating that virus titer and timing of the second infection might play a role in virus interference. This was corroborated by the results of a third study in which 10% mortality was observed among chickens that received 105EID50 of a different HPAIV [A/chicken/Jalisco/CPA-12283-12/2012 (H7N3)] 3 days after the same mesogenic NDV was given, when compared to 80% mortality observed in chickens challenged only with the HPAIV. Conclusions Previous infection of chickens with NDV can affect HPAIV replication in tissues and consequently prevent disease and mortality. This virus interference will depend on the virulence and titer of the co-infecting viruses, and the timing of the infections. The information obtained from these studies helps understand the possible interactions and outcomes of infection (disease and virus shedding) when AIV and NDV co-infect birds in the field. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P50 POSTE R A BSTRAC TS SPB2P13 Ubiquitination of the influenza A virus PB1-F2 protein is crucial for its biological functions Kosik, Ivan (1); Praznovska, Margareta (1); Kosikova, Martina (1); Vareckova, Eva (1); Kostolansky, Frantisek (1); Polakova, Katarina (2); Russ, Gustav (1) 1: Institute of virology Slovak Academy of Scince, Slovak Republic; 2: Cancer Research Institute, Slovak Academy of Sciences, Bratislava, Slovak Republic Background PB1-F2 protein was shown to affect vRdRp activity, influences pathogenesis in mouse model and increase secondary bacterial infection. It is not yet clear what the pathogenicity determinants in the PB1-F2 sequence are. Since PB1-F2 is rapidly degraded, we had supposed its biological function could be covered. Our goal was to identify determinants of the PB1-F2 stability and consequences of higher expression level in vitro and in vivo. Methods It was shown, presence of the proteasome inhibitor increased expression level of the PB1-F2. We had concluded PB1-F2 might be ubiquitinated, and we had identified C terminal lysine cluster (K73, 78, 85) as potential ubiquitination site. Proximity ligation assay (PLA) was employed to identify ubiqitination status and site of the PB1-F2. Westernblot and immunofluorescence were used to determine change in expression level of the PB1-F2. The firefly luciferase minigenome assay was used to determine effect of the PB1-F2delUBQ (K73, 78, 85R) on vRdRp activity. Secreted IFN-beta level was measured to characterize relation of the PB1-F2delUBQ on IFN-beta expression. Modulation of the humoral immune response and protection induced by DNA vaccination with PB1-F2 wt or PB1-F2delUBQ was also studied after sub lethal virus challenge. Plasmid based rescue system was used for determination of IAV PB1F2delUBQ viability and time laps microscopy was employed for observation of the cytopathic effect differences on the MDCK cells. Results PLA assay clearly show that PB1-F2 is highly ubiqitinated and that change of the K73, 78, 85R suppresses it (Fig. 1). As ubiquitination is required for proteasome targeting, its suppression led to increased expression of the PB1-F2. In comparison to wt PB1-F2 enhanced expression of the PB1-F2delUBQ increased activity of the vRdRp about 40%. As follows from body weight change and survival rate protection potential of the PB1-F2 is also enhanced in the case of the PB1-F2delUBQ DNA vaccination. Time laps microscopy revealed accelerated cytopathic effect on MDCK cells (Fig.2). Conclusions We had focused on posttranslational ubiquitination and its meaning for PB1-F2 functions. We had found out that stability of the PB1-F2 is probably most important factor determining biological importance of this influenza A virus protein. Aknowledgement This work was supported by grants VEGA 2/0085/10, 2/0176/12, 2/0100/13, 02/152/14, 02/153/14 and 2/0117/11 from the Scientific Grant Agency of the Ministry of Education of the Slovak Republic and Slovak Academy of Sciences. The topic was also supported by Grant no. APVV-0250-10, from the Slovak Research and Development Agency. Appreciably topic was further supported by Eva Varečková (DO7RP-0025-10 from the Slovak Research and Development Agency) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P51 POSTE R A BSTRAC TS Figure. 1 Figure. 2 TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P52 POSTE R A BSTRAC TS SPB2P14 In vivo Virus Tropism and Protection by a Matrix Protein 2 EctodomainSpecific Monoclonal Antibody revealed by a Novel GFP-expressing Influenza A Virus Saelens, Xavier; De Baets, Sarah; Verhelst, Judith; Van den Hoecke, Silvie; Smet, Anouk; Roose, Kenny; Schotsaert, Michael; Schepens, Bert; Fiers, Walter Ghent University and VIB, Belgium Background Background: The severity of influenza-related illness is mediated by many factors, including the in vivo cell tropism, the timing and magnitude of the immune response and the presence of pre-existing immunity. An easy way to study cell tropism and virus spread in vivo is with an influenza virus expressing a reporter gene such as GFP. However, GFP-expressing influenza viruses are often attenuated and can be genetically unstable. Methods Methods: We generated PR8-NS1(1-73)GFP virus by reverse genetics. For this, we changed the wild type NSfragment into a tri-cistronic element consisting of the coding information for the first 73 amino acid residues of NS1 fused to a heterologous dimerization domain. This truncated NS1 was followed by GFP and NEP. The virus was rescued, serially passaged in vitro and analyzed by Illumina-based deep sequencing. Pathogenicity and tropism of the PR8-NS1(1-73)GFP virus was analyzed in BALB/c mice that had been passively immunized with an M2e-specific monoclonal antibody or treated daily with oseltamivir. Stromal as well as immune cells from the lungs of infected mice were analyzed by flow cytometry. Results The recombinant GFP-expressing PR8-derived virus was successfully rescued. Serial in vitro passage and Illuminabased deep sequence analysis revealed that this virus was genetically stable. Compared to wild type PR8 the GFP virus was approximately 10-fold attenuated in BALB/c mice. Based on the GFP expression levels, the main target cells of the virus were found to be respiratory epithelial cells and myeloid cells, including dendritic cells (CD11c+) and inflammatory monocytes (CD11b+ GR1+). Prophylactic treatment with anti- M2e monoclonal antibody or daily administration of oseltamivir reduced GFP expression in all cell types studied. More than 95% of plaques derived from lung homogenates prepared on day 5 after infection were GFP-positive, suggesting that the virus was also very stable in vivo. Conclusions The in vivo cell tropism is an important virulence factors of influenza viruses. To study infection dynamics and cell tropism, GFP-reporter viruses are very useful. However, most of these viruses are unstable and attenuated in vivo. Here we describe a pathogenic PR8 virus, of which GFP expressing is stable in vitro and in vivo. Furthermore, we show that this virus is very useful to determine the protective potential of antiviral treatments in vivo, like oseltamivir and anti-M2e monoclonal antibody treatment. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P53 POSTE R A BSTRAC TS SPB2P15 Genetic background influences the antiviral activity of Mx1 gene to influenza virus infection in mice Shin, Dai-Lun (1,2); Hatesuer, Bastian (1); Schughart, Klaus (1,2,3) 1: Helmholtz Centre for Infection Research, Germany; 2: University of Veterinary Medicine Hannover, Germany; 3: University of Tennessee, Health Science Center, United-State Background In humans, there is circumstantial evidence that genetic factors may play an important role for susceptibility or resistance to influenza A viruses (IAV) infection. In mice, It was shown that mice carrying a functional Myxovirus resistance genes 1 (Mx1) allele are highly resistant against IAV. It acts as a restriction factor for virus importation and block viral replication. Thus, the discovery of Mx1 as resistance factors dates back over 50 years, a detailed phenotypic comparison between Mx1 mutant and wild type mice have not yet been performed. Furthermore, the influence with genetic background and relationship with other genes were remaining unclear. Methods Our group demonstrated that genetic background could greatly influence the severity of disease after IAV infections by comparing between the laboratory inbred strains DBA/2J (D2) and C57BL/6J (B6). In this study, we use B6.A2GMx1+/+ mice and A/Puerto Rico/8/34 H1N1 Freiburg variant virus (PR8F) as our standard setup, compared the phenotype with B6 mice which contain nonfunctional Mx1 allele. Additionally, we changed the genetic background for B6.A2G-Mx1+/+ mice from B6 into D2 background via backcross the mouse with D2 for 10 generations. Phenotypes were measured by body weight loss, survival rate and virus titer from these mouse strains. Results D2.A2G-Mx1+/+ mice were highly susceptible to IAV infection. Mice with functional Mx1 allele in D2 background reach 100% mortality after days 7 post infection. Performing the offspring F1 mice from D2.A2G-Mx1+/+ with B6, which share half B6 and half D2 genetic background with one functional Mx1 allele, the mice could regain its antiviral activity against IAV infection. Conclusions Our results suggest that B6 contain certain genes could initiate Mx1 antiviral function by restricting viral replication, which were absence in D2 mouse strain. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P54 POSTE R A BSTRAC TS SPB2P16 Genetic background influences the antiviral activity of Mx1 gene to influenza virus infection in mice Janulikova, Jana; Bobisova, Zuzana; Mucha, Vojtech; Kostolansky, Frantisek; Vareckova, Eva Institute of Virology, Slovak Academy of Sciences, 845 05 Bratislava, Slovak Republic Background Several cases of human infection caused by avian influenza A viruses (IAV) were reported recently. Because they were described as severe infections with high lethality, we studied the interaction of avian viruses with the immune system of mammalian host. We focused on the specific antibody response induced after infection of mice with avian or/and human influenza A viruses. The aim of this work was to simulate the situation, which could arise in nature in humans, i.e. the infection with avian IAV after previous infection with human viruses and to analyze the level of biologically active virus-specific antibodies induced after such subsequent mixed infection on mouse model. Methods Two avian IAV (A/Duck/56(H4N6), marked as “H4” and A/Vietnam/1203-04 (H5N1), marked as “H5”) and two human IAV isolates (virus A/Miss/1/85(H3N2)-“H3” of medium virulence and A/PR8/34(H1N1) “H1” of high virulence) were adapted to mice. The micro-neutralization and ELISA binding tests were used for analysis of virus-neutralizing (VN) and for antigen-binding antibodies specific to HA2 gp. For the infection of mice various doses of human IAV were used and specific antibody response of mice was compared with that obtained after a single or repeated infection with two identical doses of avian IAV. In parallel, an antibody response to a mixed infection with one human and subsequently with one avian influenza A virus was examined. Results We showed that two doses of identical IAV of H4 or H5 virus elicited in mice virus- specific neutralizing antibodies. In mice previously infected with human IAV (of H3 or H1 subtype), infection with H4 subtype elicited antibodies neutralizing H4 virus, but also titer increase of antibodies which neutralized the corresponding human virus used for previous infection was recorded. After successive infection with H3 and H4 viruses a subpopulation of HA2-specific antibodies cross-reactive with both subtypes was present. In mice infected with H5 virus after previous infection with human IAV of H1 or H3 subtype, no measurable levels of antibodies neutralizing H5 virus were induced. Notably, after infection with H5 virus, a significant titer increase of antibodies neutralizing IAV of H1or H3 subtype (in dependence of the virus used for the first infective dose) was detected in sera of these mice. Conclusions Different antibody response to avian IAV after previous infection with human viruses can play an important role in the epidemiology of newly emerged IAV of avian origin in human population. Supported by grants: VEGA 2/0176/12, VEGA 2/0100/13, VEGA-2/0153/14, grants APVV- 0250-10 and DO7RP-0025-2010 from the Slovak Research and Development Agency. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P55 POSTE R A BSTRAC TS SPB2P17 Virus dose-dependent neutrophil and lymphocyte proportions in peripheral blood during influenza A infection of mice Kostolansky, Frantisek (1); Dugovicova, Veronika (1); Janulikova, Jana (1); Mucha, Vojtech (1); Mistrikova, Jela (2); Vareckova, Eva (1) 1: Institute of Virology, Bratislava, Slovak Republic; 2: Dept. Microbiology and Virology, Comenius University, Slovak Republic Background In this study, we focused on monitoring the changes in the proportion of cell types in the peripheral blood of mice infected with mouse-adapted human influenza A viruses (IAVs). Our aim was to determine how the changes in the differential leukocyte count correlate with the virulence and the dose of IAV used for the infection. Methods BALB/c mice were infected with sublethal dose (0.4 LD50 or 0.1 LD50) of moderately virulent IAV strain A/ Mississippi/1/85 (H3N2) – “Miss”, or of highly virulent A/PR/8/34 (H1N1) – “PR8”. Control (non-infected) mice were given PBS. Differential leukocyte counts were done by microscopic examination of blood smears stained by the May- Grunwald solution, followed by the Giemsa-Romanowski solution. Differential white blood cell counts were calculated as a percentage of each kind of white blood cells. Results The infection with 0.4 LD50 of the virus Miss led to a 3-fold increase in the neutrophil count on day 2 p.i. with subsequent decrease and returned to the normal level on day 10 p.i. In contrast, the proportion of lymphocytes dropped by 18% on day 2 p.i., then gradually rose nearing the normal level. Other leukocyte subpopulations did not show any marked changes during the IAV infection. The infection with a lower dose (0.1 LD50) of the Miss virus revealed similar changes in monitored blood cell parameters: increase of neutrophil count by 8% and decrease of lymphocyte count by 8% on day 2 p.i. The PR8 infection with 0.4 LD50 have shown the same picture: a significant increase of neutrophil counts (more than two-fold compared with uninfected animals) on day 2 p.i., followed by a decrease to the normal level. At the same time, the number of lymphocytes dropped by 15.6%. Again, no other group of white blood cells displayed any significant changes. Similar effects occurred after infection with lower (0.1 LD50) dose, with the return to the normal values on day 7 p.i. Conclusions In conclusion, the changes in differential leukocyte count caused by the infection with the human IAV were dosedependent, i.e. the changes were milder upon the infection with a lower virus dose. However, they did not depend on the virulence of the virus used for infection. Acknowledgements. This work was supported by Grants VEGA: 2/0117/11, 2/0176/12, 2/0100/13 and 1/0185/11 from the Scientific Grant Agency of the Ministry of Education of the Slovak Republic and Slovak Academy of Sciences, and by grant from the Slovak Research and Development Agency under the Contract No. APVV-0250-10. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P56 POSTE R A BSTRAC TS SPB2P18 Heterogeneous pathological outcomes after experimental pH1N1 influenza infection in ferrets correlate with viral replication and host immune responses in the lung. Vidana, Beatriz (1,3); Martínez, Pamela (3); Martínez, Jorge (1,3); Montoya, María (3,4); Martorell, Jaime (2); G. Migura, Lourdes (3); Majó, Natàlia (1,3) Centre de Recerca en Sanitat Animal (CReSA), Spain; 2: Departament de Medicina i Cirurgia Animals, Universitat Autònoma de Barcelona, Spain; 3: Departament de Sanitat i Anatomia Animals, Universitat Autònoma de Barcelona, Spain; 4: Institut de Recerca i Tecnologia Agroalimentaria (IRTA), Barcelona, Spain Background The pH1N1 infection caused a variety of illness among the human population. The reason behind these varying susceptibilities is unknown, but it has been suggested that may be due to host genetic variations associated with inappropriate immune responses against viral characteristics. This study intends to evaluate whether the pathologic patterns of influenza strains that produce different disease outcomes in healthy young humans could be reproduced in a ferret model, and which immune-pathologic features were related to the disease outcome. Methods Ferrets were infected with two pH1N1 viral isolates (R11 and R61) from healthy young adults which developed different disease outcomes (mild symptoms and death). Lung histopathological examination, viral detection and quantification by immunohistochemistry (IHC) and RT-qPCR were carried out at 4 and 7 dpi. Phenotyping and quantification of the inflammatory cell populations in the lungs were performed by IHC and correlated with the lung expression of different proinflammatory molecules by RT-qPCR. The gene expression of pro- apoptotic markers was quantified by RT-qPCR and related with the apoptotic cells observed in the lungs by IHC. Results Severity of infection did not correlate with the clinical phenotype observed in humans and did not correspond to any viral isolate in particular (Figure 1). Severe lung lesion was associated with higher viral replication in alveolar areas and with an exacerbated innate cellular immune response. This response was characterised by substantial phagocytic and cytotoxic cell migration into the lungs (Figure 2), accompanied by elevated expressions of proinflammatory cytokines and the down-regulation of IFNα in the lungs. Severe lesions were associated with greater up-regulations of pro-apoptotic markers and higher accounts of apoptotic phagocytic cells. Conclusions Severe outcomes observed in infected ferrets were consequence of viral replication in alveolar areas which depended on host capacities to mount an early efficient immune response. These results support viral replication and the correct orchestration of the early inflammatory response as key factors in the outcome of the disease. This work is currently submitted to the Veterinary Research Journal for revision. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P57 POSTE R A BSTRAC TS SPB2P19 Species-specific host factors for Influenza A Virus replication Martin-Sancho, Laura (1); Karlas, Alexander (1); Imai, Aki (1); Barclay, Wendy (2); Meyer, Thomas F. (1) 1: Max Planck Institute for Infection Biology, Germany; 2: Imperial College London, UK Background Typical avian influenza A virus (IAV) strains show limited replication in species other than aquatic birds, their natural host. To become adapted to other hosts, the virus has to overcome host species barriers. It is hypothesized that these barriers could be partially due to differences in host cell factor requirements. Five RNAi-based screens have identified multiple host factors essential for IAV replication in human cells, but requirements in other host species are unknown. The aim of this study is to identify similarities and differences in terms of host factor requirements in the human, the avian and the porcine host. Methods Using our existing high-throughput-siRNA screening platform, chicken and porcine cells were transfected with custom-made siRNAs. The screen assessed viral replication, cell viability and interferon induction. Hits were validated in primary lung epithelial cells established in-house. Positive hits are subjected to polymerase assays, confocal microscopy and immunoprecipitation assays for further investigation. Results Using data from the published screens, we identified 84 genes that have avian and porcine orthologs and confirmed expression in our cell lines using microarrays. After excluding toxic and immunostimulatory siRNAs, bioinformatics analyses revealed 30 genes required for influenza virus replication in all three species. Many of these were associated with mRNA splicing, nuclear transport and cellular trafficking. In addition, we identified 13 genes required by the virus in either human or porcine but not in avian cells. After validating these hits in lung epithelial cells, different assays are currently ongoing to help us uncover the role of those factors in the viral cycle. Conclusions This siRNA cross-species screen will elucidate the role of specific host factors in IAV tropism, helping us to understand the requirements for efficient replication and transmission of avian viruses in mammalian cells, and providing novel target candidates for host-directed therapy. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P58 POSTE R A BSTRAC TS SPB2P20 The relevance of cell cycle manipulation of influenza A virus to virus pathogenicity Xu, Ke Institut Pasteur of Shanghai, Chinese Academy of Sciences, China, People’s Republic of Background Cell cycle is a fundamental activity for the host cells, especially when reproduction of cells is demanded under the evasion of pathogens. By contrast, viruses develop different strategies to manipulate the host cell cycle for their own benefits. We previously demonstrated that influenza A virus promotes its propagation by arresting the host cell cycle at G0/G1 phase. However, whether cell cycle manipulation of influenza A virus is biological relevant to disease outcomes and pathogenicity is still unknown. Methods The cell cycle profiles of cells infected with different strains and subtypes of influenza A viruses were analyzed by FACS assay. A genomic-wide screening was applied to identify the responsible viral components for arresting the cell cycle. A crucial host molecule was found to be targeted by influenza A virus for cell cycle arrest, and the interaction motif was discovered by mutagenesis. Recombinant virus deficient in arresting the cell cycle was rescued by reverse genetics to infect cell cultures and mice. The proliferation of T cells from the infected animals was further analyzed. Results We found that arresting the host cell cycle at G0/G1 phase is a universal strategy exploited by influenza A viruses, but the strength of cell cycle arrest differs among subtypes. In general, it is more conserved for human viruses than for avian viruses to induce a cell cycle arrest in human epithelium and T cells. The human cleavage and polyadenylation specificity factor 30 (CPSF30), whose expression is essential for cell cycle progression, is targeted by viral proteins. By binding to CPSF30 and subsequently inhibiting CPSF30 activity, influenza A virus heavily arrested the host cell cycle at G0/G1 phase. The recombinant virus defective in cell cycle arrest was highly attenuated in CPSF30-competent cells but not in CPSF30-deficient cells. In WT virus infected mice, the proliferation of T cells was severely inhibited and the mice were totally dead under the challenge of high virus load. However, in mice infected with the same amount of cell cycle arrest-deficient virus, we observe a normal T cell proliferation and 100% survival. The data indicate that the ability to induce cell cycle arrest contributes to influenza A virus pathogenicity probably though inhibiting the proliferation of immune cells. Conclusions With the fact that CPSF30 is curial for a normal cell cycle, influenza A virus uses two of its viral proteins to hijack CPSF30 for manipulating host cell cycle. By arresting the cell cycle at G0/G1 phase, influenza A virus creates a favorable in vivo environments for itself that will finally lead to a high pathogenicity. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P59 POSTE R A BSTRAC TS SPB2P21 The adaptation of avian influenza viruses to the respiratory epithelium of pigs Yang, Wei (1); Meng, Fandan (1); Punyadarsaniya, Darsaniya (2); Hoffmann, Markus (1); Stech, Juergen (3); Hoeper, Dirk (3); Beer, Martin (3); Schwegmann-Wessels, Christel (1); Ren, Xiaofeng (4); Herrler, Georg (1) 1: Institute of Virology, University of Veterinary Medicine, Hannover, Germany;; 2: Institute of Virology , Mahanakorn University of Technology, Bangkok, Thailand;; 3: Friedrich Loeffler Institut, Bundesforschungsinstitut für Tiergesundheit, Greifswald, Germany; 4: College of Veterinary Medicine, Northeast Agricultural University, Harbin, China Background Pigs are an important host for influenza A viruses and may play a crucial role in the interspecies transmission. To analyze the infection by influenza viruses, we have established precision-cut lung slices from the porcine lung as a culture system for differentiated respiratory epithelial cells. As differentiated repiratory epithelial cells are the primary target cells for influenza virus infections, precision-cut lung slices provide an interesting system to analyze the adaptation of avian influenza viruses to the respiratory epithelium of pigs. Avian influenza viruses H9N2 subtype have been circulating worldwide in multiple avian species and have repeatedly infected mammalian to cause typical disease. The continued avian-to-mammalian interspecies transmission of H9N2 viruses raises concerns about the possibility of viral adaption with increased virulence for humans and poses a potential health risk to the public. Methods Avian influenza viruses H9N2 subtype were subjected to several passages in precision-cut lung slices. Then the changes in the viral properties that are associated with the adaptation process were characterized by analyzing: (1) duration of the growth cycle; (2) amount of infectious virus released into the supernatant; (3) extent of the ciliostatic effect. Sequence analysis will reveal which amino acid changes occur during the different virus passages Results Adaptation of the avian viruses to growth in porcine cells was evident in a shortening of the growth cycle. Sequence analysis revealed that few amino acid changes occurred during the different virus passages. The importance of the individual mutations is currently analyzed by generating recombinant viruses that contain the respective mutated proteins. Conclusions Our study will help to understand the processes involved in the adaptation of H9N2 influenza viruses to new hosts. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P60 POSTE R A BSTRAC TS SPB2P22 The effect of Streptococcus suis co-infection on the infection of welldifferentiated porcine respiratory epithelial cells by swine influenza viruses Meng, Fandan (1); Wu, Nai-Huei (1); Seitz, Maren (2); Valentin-Weigand, Peter (2); Ren, Xiaofeng (3); Herrler, Georg (1) 1: Institute of Virology, University of Veterinary Medicine, Hannover, Germany; 2: Institute of Microbiology, University of Veterinary Medicine, Hannover, Germany; 3: College of Veterinary Medicine, Northeast Agricultural University, Harbin, China Background Disease often occurs due to a combination of various factors including viral and bacterial pathogens as well as environmental factors. A major factor responsible for severe virus infections may be bacterial co-infections. As known, pigs are important hosts for influenza A viruses and may play an important role in the interspecies transmission of influenza viruses. Primary target cells for Influenza viruses are the epithelial cells in the respiratory tract. Differentiated airway epithelial cells contain special cell types such as ciliated cells or mucus-producing cells that can’t be maintained as immortalized cell cultures. Methods We have recently reported a culture system for differentiated respiratory epithelial cells to analyze the infection of porcine influenza viruses in their natural target cells. Therefore, the aims of this study are to analyze the effect of Streptococcus suis (S.suis) co-infection on the infection of well-differentiated porcine respiratory epithelial cells by porcine influenza virus types H1N1 and H3N2.The comparison of mono- and co-infection reveals to what extent the bacterial infection enhances the severity of infection by porcine influenza virus. Results We compared five porcine viruses of the three subtypes currently prevalent in the swine populations (H3N2, H1N1, H1N2) with respect to the following parameters: (1) duration of the growth cycle; (2) amount of infectious virus released into the supernatant; (3) extent of the ciliostatic effect. These viruses showed differences in their growth behavior and ciliostatic effect on PCLS and thus reflected the virulence properties of these viruses. Conclusions Our co-infection studies will reveal whether S.suis differentially affects influenza viruses differing in their virulence. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P61 POSTE R A BSTRAC TS SPB2P23 Streptococcus suis affects the replication of swine influenza virus in porcine tracheal cells Wu, Nai-Huei (1); Meng, Fandan (1); Seitz, Maren (2); Valentin-Weigand, Peter (2); Herrler, Georg (1) 1: Institute for Virology, University of Veterinary Medicine Hannover, Germany; 2: Institute for Microbiology, University of Veterinary Medicine Hannover, Germany Background Swine influenza viruses (SIV) are important pathogens affecting pigs of all ages. Surveillance data show that 31% of European pig farms are exposed to SIV. Streptococcus suis is one of the most important bacterial respiratory pathogens in the swine population. Secondary infection by S. suis may enhance the severity of disease in piglets infected by SIV resulting in huge economic losses. To date, the relationship between SIV and S. suis still remains unclear. In order to understand the interaction between SIV and S. suis, we established an in vitro co-infection model based on newborn pig trachea cells (NPTr). Methods Two SIV variants A/sw/Bad Griesbach/IDT5604/2006 H1N1 and A/sw/Herford/IDT5932/2007 H3N2 were used to compare subtype differences. Our previous studies showed that this H3N2 strain had a higher replication rate and induced a strong ciliostatic effect in pig precision-cut lung slices, while the H1N1 strain only had a mild effect on the ciliary activity. Wild type S. suis (WT) and an noncapsulated mutant strain (Δcps) were selected as secondary bacterial pathogens in this study. NPTr cells were infected with different combinations, first inoculated with SIV, followed by bacterial inoculation. The course of infection was monitored by immunofluorescence microscopy and by determining the virus titers at different time points. Results After SIV infection, the adhesion rate of WT bacteria was enhanced. Different from Δcps, most of the WT bacteria adhered to SIV infected cells. Furthermore, the viral replication rates of both H1N1 and H3N2 SIV were reduced when cells were co-infected by S. suis WT strain. Interestingly, the virus titers in WT co-infected groups were ten-fold lower than in SIV mono-infection or Δcps co-infected groups at 24 h.p.i. Conclusions These results indicate that S. suis and SIV affect each other in the infectious behavior in our NPTr cell model. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P62 POSTE R A BSTRAC TS SPB2P24 Virus and host determinants of influenza A virus restriction by human MxA Patzina, Corinna; Riegger, David; Haller, Otto; Kochs, Georg Institute for Virology, University Medical Center Freiburg, Germany Background Human myxovirus resistance protein MxA is an interferon-induced effector with a broad spectrum of antiviral activity against divergent viruses, e.g. orthomyxo- or bunyaviruses. MxA-mediated inhibition of influenza A virus (FLUAV) replication is dependent on the virus strain, as viruses of avian origin are more sensitive to MxA than human strains. An accessible patch of amino acids in the viral nucleoprotein (NP) determines MxA sensitivity, implying that MxA specifically recognizes FLUAV NP. However, it is still unclear how MxA can inhibit the replication of such a broad range of viruses. Methods To validate the relationship between Mx resistance and adaptive mutations in NP, virus evolution assays were performed in vivo. Therein, a recombinant human A/PR/8/34 carrying two avian NP mutations that render the virus sensitive to Mx action, PR8(mut), was passaged in Mx1-positive mice and screened for emerging adaptive mutations. To identify sites in human MxA that determine its specificity to FLUAV and to related orthomyxoviruses, a comparative analysis of primate MxA proteins was performed. Sites with strong signatures of positive selection, a marker of hostpathogen interfaces, were characterized for their impact on orthomyxovirus restriction and vRNP recognition. Results PR8(mut) was highly attenuated in Mx1-positive mice when compared to the parental strain, but regained its replicative potential upon consecutive lung passages in these mice. Thereby, two non-synonymous mutations emerged in NP that are in close proximity to the previously characterized amino acid patch determining Mx resistance of human FLUAV strains. In vitro experiments supported the increase of Mx resistance of PR8(mut) mediated by a single adaptive NP mutation. In addition, an evolution-guided analysis of MxA revealed its overall high conservation with a limited set of amino acids evolving under strong positive selection. These residues mainly cluster in loop L4, a surface-exposed, flexible domain that protrudes from the highly ordered stalk of MxA. The minimal motif in loop L4 of MxA required for orthomyxovirus specificity and vRNP recognition consists of the positively selected Phe- 561 and neighbouring residues. Conclusions We were able to confirm the ability of FLUAV to overcome restriction by Mx through single mutations in an accessible region of NP. Interestingly, the virus did not adapt by back- mutating the initially altered residues, implying that a potential Mx-NP interface in this region can be affected by divergent changes. The host protein MxA shows signatures of continuous host-virus arms races, especially in the surface-exposed loop L4, wherein single residues determined orthomyxovirus specificity. We hypothesize that MxA restricts FLUAV by a direct interaction of loop L4 with NP, most likely by multiple contacts of an MxA oligomer with FLUAV nucleocapsids, and we hope that further understanding the host’s defense system might result in novel therapeutic strategies against highly pathogenic FLUAV strains. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P63 POSTE R A BSTRAC TS SPB2P25 Viral replication kinetics and pathogenesis of pandemic H1N1 and H7N9 influenza virus infection in isogenic guinea pigs Wiersma, Lidewij (1); Kreijtz, Joost (1); van Trierum, Stella (1); Nieuwkoop, Nella (1); van Run, Peter (1); van Amerongen, Geert (1); Ladwig, Mechthild (2); Banneke, Stefanie (2); Schaefer, Hubert (3); Osterhaus, Ab (1); Rimmelzwaan, Guus (1) 1: Erasmus Medical Centre, Netherlands, The; 2: Federal Institute for Risk Assessment, Berlin, Germany; 3: Robert Koch Institute, Berlin, Germany Abstract Isogenic guinea pigs uniquely combine the virtues of the mouse and ferret models for influenza A virus infection. Like mice, they are inbred and therefore suitable for studies on cellular immunity and, like ferrets, they effectively transmit the virus. In order to pave the way for new lines of research into viral transmission and cellular immunity, a baseline study was performed to assess replication kinetics and the pathogenesis of pandemic H1N1 (pH1N1) and H7N9 virus infection in this particular strain of guinea pigs. Forty female isogenic guinea pigs 12-16 weeks were kept under biosafety level 3 conditions and inoculated with pH1N1 virus intranasally (IN n=12) or intratracheally (IT n=10) and sacrificed on day 1, 2, 3, 4 or 7. Remaining animals were inoculated IT with either H7N9 virus (n=12) or PBS (n=6) and sacrificed on day 2 and 7. Swabs were taken daily and full necropsies were performed. Infectious virus titres in tissue samples and swabs were determined using standard methods and immunohistochemical (IHC) and histopathological changes were evaluated by light microscopy. Virus inoculated animals showed peak average viral titres in nasal secretions at day 2 post-inoculation (pi) and by day 7 pi infectious virus was no longer detectable for pH1N1 and low for H7N9 virus inoculated animals. Intranasal inoculation with pH1N1 resulted in higher peak viral excretion via the nose than IT inoculation. pH1N1 IN inoculated guinea pigs showed viral titres in only nasal epithelium at day 4. For pH1N1 IT inoculated animals, infectious virus was recovered up to day 4 from nasal epithelium, trachea, lung and cerebral tissue. For H7N9 IT inoculated animals, virus was recovered from nasal epithelium, lung, cerebrum and trachea on day 2 as well as nasal epithelium on day 7. Histological evaluation revealed more widespread and severe lesions after IT than IN inoculation for pH1N1. Overall, H7N9 inoculated animals showed the most severe lesions. Immunohistochemically, viral antigen positive cells were restricted to the nasal cavity for pH1N1 IN inoculation. For IT inoculation of both pH1N1 and H7N9, viral antigen was more diffusely dispersed in epithelial cells of the respiratory tract and alveolar macrophages around day 2 and still present in the lung and nasal epithelium respectively by day 7. For future research, isogenic guinea pigs show promise as a model for cellular immunity and transmission of influenza viruses. Additionally, the data highlight the importance of early time points and the advantages of the intratracheal route of inoculation. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P64 POSTE R A BSTRAC TS SPB2P26 The contribution of the PB1-F2 protein to viral virulence and pathogenesis of avain influenza virus James, Joe (1,2); Moncorgé, Olivier (2); Barclay, Wendy (2); Shelton, Holly (1) 1: Avian Infectious Disease Programme, The Pirbright Institute, Compton Laboratory, Compton, Berkshire, UK; 2: Faculty of Medicine, Imperial College London, UK Background The PB1-F2 protein is translated from the +1 frame of the genetic segment that encodes for the influenza virus RNA polymerase, PB1. Work in mammalian systems has shown PB1-F2 to have a range of effects dependent upon cell type and viral strain. These activities include pro-apoptotic and pro-inflammatory functions, modulation of the innate immune response, and regulation of viral polymerase activity. The PB1-F2 protein is often truncated or missing in influenza viruses isolated from mammals. However 96% of all avian influenza isolates possess a full length PB1-F2 gene, suggesting a unique function in the avian host. To date, only limited studies have been undertaken in avian systems and the role of PB1-F2 in the avian host remains to be fully elucidated. Here, using prototypical H9N2 and H5N1 influenza strains of utmost importance to the poultry industry, we begin to examine the role of the PB1-F2 protein in influenza infection of poultry. Methods Using reverse genetics we generated isogenic viruses based on two different avian influenza virus backgrounds that differed only in the length of the PB1-F2 protein which they produce but with no alteration to the other viral proteins produced from the PB1 segment. We assessed the contribution to viral virulence by PB1-F2 using a chicken embryonic lethality assay, where groups of chicken embryos were infected with decreasing concentrations of influenza viruses and the percentage of eggs reaching the experimental endpoint determined. To assess viral polymerase modulation, mutations to truncate the PB1-F2 protein were made in the context of a PB1 expression plasmid and used a viral mini-replicon assay in DF-1 cells. Immune modulation was assayed via qRT-PCR for innate immune related transcripts and with a chicken specific interferon-β promoter reporter. Results Using the in ovo lethality assays, we show that truncation of PB1-F2 from full length decreases the minimum lethal dose. We show that full length PB1-F2 significantly up- regulated viral polymerase activity in chicken cells using the in vitro minireplicon assay system. Although in the context of whole virus, PB1-F2 had little effect upon the replication kinetics of a multi-cycle growth curve in chicken cells or embryos. However, expression of avian PB1-F2 was able to modulate the innate immune response via antagonism of the chicken type I interferon system. Conclusions We speculate that PB1-F2 modulates the innate immune response during virus infection in chickens and loss of the C-terminus results in dysregulation and consequently a more severe outcome of infection. This knowledge will facilitate enhanced predictions of pathogenicity in poultry based upon available sequence data, allowing for more informed decisions about the course of action during influenza outbreaks in poultry. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P65 POSTE R A BSTRAC TS SPB2P27 Hemagglutinin 222D/G polymorphism of pandemic influenza A (H1N1) 2009 viruses enables fast intra-host evolution and causes severe biphasic influenza in mice Seidel, Nora; Sauerbrei, Andreas; Wutzler, Peter; Schmidtke, Michaela Jena University Hospital, Department of Virology and Antiviral Therapy, Jena, Germany Background The HA-222D/G polymorphism of pandemic (H1N1) 2009 influenza viruses (A(H1N1)pdm09) was frequently reported in severe and fatal influenza in humans and mice. Its impact on viral pathogenicity and the course of disease has been discussed controversially and the underlying mechanism remained unclear. Methods Using BALB/c mice infected with the once mouse lung- and cell-passaged A(H1N1)pdm09 isolate A/Jena/5258/09 (mpJena/5258; biphasic disease: Manchanda et al. 2014 Biosystems) and A/swine/Potsdam/15/81 (mpPotsdam/15; monophasic disease), we followed the evolution of HA-222, which is within the host receptor binding and antigenic sites, in different stages of infection and characterized its polymorphism in lung and trachea. Symptoms were monitored daily based on body weight loss and clinical score. Results As expected, infection of mice resulted in one (mpPotsdam/15) or two symptom peaks (mpJena/5258) on day 7 or 4 and 7 p.i., respectively. In mpJena/5258-infected mice, HA-222D/G polymorphism was detected in virus isolates from lung as well as trachea. Two virus titer maxima in lung and trachea preceded the symptom peaks. The first peak was 45-fold higher in the lung and the second was 13-fold higher in trachea virus titers. These results indicated a change in organ tropism during virus infection. The change in organ tropism was accompanied by increased detection of HA-G222 quasispecies in both organs. In the trachea, but not in the lung, HA-G222 became the major quasispecies after day 4 p.i. Because HA-222 is part of the antigenic site Ca and the receptor binding site, both mpJena/5258 quasispecies were plaque-purified and the antibody binding as well as the receptor recognition was examined. The results demonstrate an impaired neutralization and a broader receptor recognition including terminal Nacetylneuraminic acid α-2,3-linked to galactose (abundantly expressed in trachea) of HA-G222 quasispecies. The latter was also confirmed for mpPotsdam/15 that exhibit only HA-G222. In additional mouse studies we showed that these specific HA-G222 characteristics enabled replication of the plaque-purified HA-G222-mpJena/5258 and mpPotsdam/15 virus with high viral titers in lung and trachea. A continuous worsening of symptoms in BALB/c mice was observed. Only HA-G222 quasispecies were detected by sequencing of isolates from tissue samples. Conclusions These results demonstrate that quasispecies with a HA-222D/G polymorphism facilitate fast viral intra-host evolution based on partial antibody escape and minor changes in receptor binding, resulting in an altered virus tropism and severe influenza in mice. Detection of virus polymorphism in the early stage of infection might guide to a better treatment of the disease. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P66 POSTE R A BSTRAC TS SPB2P28 TMPRSS2 is a host cell factor that is essential for pneumotropism and pathogenicity of H7N9 and H1N1 influenza A virus in mice Tarnow, Carolin (1); Engels, Geraldine (2); Arendt, Annika (1); Schwalm, Folker (1); Sediri, Hanna (1); Garten, Wolfgang (1); Klenk, Hans-Dieter (1); Gabriel, Gülsah (2); Böttcher-Friebertshäuser, Eva (1) 1: Institute of Virology, Philipps-University Marburg, Marburg, Germany; 2: Heinrich-Pette-Institute, Leibniz Institute for Experimental Virology, Hamburg, Germany Background Cleavage of the hemagglutinin (HA) by host proteases is a prerequisite for fusion activity and, thus, for influenza virus infectivity. HA cleavage has been shown to be a prime determinant of avian influenza virus pathogenicity in poultry, but little is known about its relevance for pathogenesis in mammals. We identified the serine protease TMPRSS2 (transmembrane protease serine S1 member 2) as a protease present in the human airways that activates influenza virus HA with monobasic cleavage site. Here, we have analysed the role of TMPRSS2 on influenza virus pathogenesis in a mouse model. We show that knockout mice that do not express TMPRSS2 are resistant to pulmonary disease with lethal outcome when infected with H7N9 and H1N1 influenza A viruses, whereas they are not protected from lethal H3N2 virus infection. Methods and Results Replication of the human H7N9 isolate A/Anhui/1/13 and of human H1N1 and H3N2 viruses was compared in TMPRSS2-knockout (TMPRSS2-/-) and wildtype (WT) mice. Knockout of TMPRSS2 expression inhibited H7N9 influenza virus replication in explants of murine trachea, bronchi and lung. Similarly, H1N1 virus replication was strongly suppressed in airway explants of TMPRSS2-/- mice, while H3N2 virus replication was only marginally affected. H7N9 and H1N1 viruses were apathogenic in TMPRSS2-/- mice, whereas WT mice developed severe disease with mortality rates of 100% and 20%, respectively. Immunohistochemical analysis of viral antigen expression revealed that knockout of TMPRSS2 prevented virus spread into the lung. In contrast, all H3N2 infected TMPRSS2-/- and WT mice succumbed to lethal infection. Cleavage analysis in vitro showed that H7 and H1 are efficiently activated by TMPRSS2, whereas H3 is less susceptible to the protease. It is currently under investigation what contributes to the observed differences in protease specificity of H1 and H7, on one hand, and of H3, on the other hand. Conclusions Our data demonstrate that the host protease TMPRSS2 is essential for pneumotropism and pathogenicity of H7N9 and H1N1 influenza virus in mice. In contrast, replication of H3N2 virus appears to depend on another, not yet identified protease. These findings support the concept that human influenza viruses differ in protease specificity, and demonstrate that expression of the appropriate protease along the respiratory tract is essential for pneumotropism and pathogenicity. Furthermore, the data show that HA-activating proteases and in particular TMPRSS2 are promising drug targets that should be considered for influenza therapy. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P67 POSTE R A BSTRAC TS SPB2P29 H7N9 influenza A viruses exhibit importin-α mediated replication in the mammalian respiratory tract Bertram, Stephanie (1); Schwalm, Folker (2); Preuß, Annette (1); Klenk, Hans-Dieter (2); Gabriel, Gülsah (1) 1: Heinrich-Pette-Institute, Leibniz Institute for Experimental Virolo Pneumonia complicated by respiratory distress is the leading cause of death in influenza A virus infected patients. Previously, we have shown that the importin-α7 gene plays a major role in the development of pneumonia and respiratory distress by promoting influenza virus replication in the lower respiratory tract of mammalian animal models. Here, we have analyzed whether a recently emerged avian H7N9 influenza virus that has crossed species barriers and infected humans leading to high case fatality rates shows adaptive features towards human host factors that promote virus replication in the lung. Using a cell-based polymerase activity assay in combination with siRNAmediated silencing for importin-α isoforms, we could detect a decreased H7N9 polymerase activity in human cells. Consistently, virus replication was impaired in human importin-α7 silenced lung cells. Moreover, H7N9 infected mice lacking the importin-α7 gene showed impaired pulmonary virus titres associated with reduced lung injuries and enhanced survival compared to wildtype mice. In summary, our results show that H7N9 influenza viruses show distinct features of adaptation to human host factors. In particular, adaptation of H7N9 influenza viruses to importin-α7 might have contributed to elevated virus replication in the lower respiratory tract leading to pneumonia and high case fatality rates among humans. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P68 POSTE R A BSTRAC TS SPB2P30 PI3K-gamma activation during influenza A infection induces type I and type III IFN responses and resolution of inflammation via p38 activation Garcia, Cristiana Couto (1); Tavares, Luciana Pádua (1); Dias, Ana Carolina Fialho (1); Queiroz-Junior, Celso (1); Lima, Braulio Henrique Freire (1); Machado, Alexandre Magalhães Vieira (2); Sousa, Lirlândia Pires (1); Russo, Remo Castro (1); Teixeira, Mauro Martins (1) 1: UFMG, Brazil; 2: CPqRR, Fiocruz, Brazil Background PI3Kγ is mainly expressed by leukocytes, is activated by GPCRs coupling and is involved in cell migration under inflammatory conditions. Influenza A virus causes a common and severe pulmonary disease that affects millions of people worldwide every year. Influenza NS1 binds and activates class IA PI3K and induces viral entry into host cell, but also immune responses. Specific involvement of PI3Kγ was never assessed during influenza infection. Methods C57/BL6 WT and PI3Kγ KO mice from Center of Bioterism of UFMG were used for in vivo and ex vivo experiments. Mice were infected with 104 PFU of influenza A/WSN/33 H1N1 or A/PR/8 H1N1 and were monitored for weight loss and lethality for 21 days (WSN and PR8) or euthanized (WSN) at 3, 5 and 7 days after infection to analyze viral loads (plaque assay), leukocyte infiltration (cell counts and FACS analysis) and activation (chemoluminescence), lung damage (histology) and production of cytokines and ISGs (ELISA, qRT-PCR) and activation of signaling pathways (Western Blot). Ex vivo infection with WSN (MOI 3.0) were performed in bone marrow derived macrophages (BMDM) from WT and KO mice for assessment of signaling molecules and type I IFN and ISG RNA. Results PI3Kγ KO mice were more susceptible to WSN and PR8 infection with enhanced lethality and weight loss rates. Neutrophil infiltration and ROS production in lungs and lung damage were higher in KO mice; however there is a reduction in infiltration of macrophage, especially the pro-resolving population (Gr1- F4/80med CD11blow), and NK and CD8+ T cells in KO mice after seven days. In all evaluated time points after infection, type I IFN (IFN-α4 and IFN-β1) and type III (IFN-λ) RNA levels are strikingly reduced in lungs of KO mice compared to WT. Whereas RNA from ISG15, Mx2 and ddx58 is highly enhanced in KO mice, protein levels of ISG15 and RIG-I were similar in WT and KO. P-p38 is reduced in KO mice. Viral loads are increased in early and late time points in KO mice. To investigate the mechanisms of ISG induction we performed ex vivo experiments. In BMDM, type I IFN RNA is enhanced in WT cells after 24 hours but not in KO; ISG15 and Mx2 RNA is enhanced after 2 and 6 hours, before type I IFN induction and P-p38 is reduced in KO. The blockade of P-p38 during infection reduces ISG15 protein in WT cells is same levels as KO untreated cells. Conclusions PI3Kγ is necessary for effective type I IFN antiviral responses and resolution of inflammation induced by influenza infection. PI3Kγ KO induces an IFN- independent induction of ISGs RNA that are not translated into protein. Therefore, PI3Kγ via p38 might be involved in postracriptional regulation of ISGs. Financial support: CNPq/CAPES/FAPEMIG TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P69 POSTE R A BSTRAC TS SPB2P31 Replicative Fitness of Avian Influenza A(H7N9) Virus Variants with Reduced Susceptibility to Neuraminidase Inhibitors in Mice and Ferrets Henju Marjuki (1), Vasiliy P. Mishin (1), Anton P. Chesnokov (1), (2), Joyce Jones (1), Juan A. De La Cruz (1), (2), Katrina Sleeman (1), Ho-Sheng Wu3, Feng-Yee Chang3, Ming-Tsan Liu3, Alicia M. Fry (1), Nancy J. Cox (1), Julie M. Villanueva (1), Charles T. Davis (1), Larisa V. Gubareva (1) 1: Influenza Division, National Center for Immunization and Respiratory Diseases, Centers for Disease Control and Prevention, Atlanta, GA, USA, 2: Battelle Memorial Institute, Atlanta, GA, USA, 3: Taiwan Centers for Disease Control, Taipei City, Taiwan Background Neuraminidase (NA) inhibitors (NAIs) have been used for treatment of patients with influenza A(H7N9) virus infections. The efficacy of NAIs, however, can be compromised by the emergence of drug-resistant viruses. Four NA variants with mixed bases encoding amino acid substitutions at positions E119V, I222K, I222R or R292K were detected in a single virus isolate, A/Taiwan/1/2013 (H7N9), recovered from an oseltamivir-treated patient. Methods Virus variants with a single amino acid substitution in the NA were detected using the CDC pyrosequencing assay during the initial screening of the isolate. Each NA variant was plaque-purified and sequenced for full genome analysis. The fluorescent NA inhibition assay was used to assess susceptibility to NAIs zanamivir, oseltamivir, peramivir, and laninamivir. Replicative fitness of each variant was assessed in cell cultures and in mice and ferrets. Results The NA substitutions identified in this study have the potential to reduce clinical susceptibility to one or more NAIs based on the results of the NA inhibition assay. In MDCK cells, all NA variants replicated to comparably high titers, while in MDCK-SIAT1 cells, the NA-R292K variant exhibited delayed growth. Depending on the inoculation dose given, mice infected with any variant developed signs of severe disease with a high mortality rate. Notably, both wild type and NA-R292K viruses were the least virulent in mice, while NA-I222K was the most virulent. An additional internal protein gene substitution at position PB2-S714N appeared to cause increased virulence of the NA-I222K variant in mice, while NS1-K126R, alone or in combination with PB2-V227M, produced contrasting effects. In ferrets, all viruses replicated to high titers in the upper respiratory tract, but despite a high inoculation dose, none developed severe infection. The NA-R292K virus showed reduced replicative fitness in ferrets, and infection with this virus did not cause weight loss. Conclusions Collectively, the results suggested a host-dependent effect on replicative fitness of H7N9 NA variants analyzed in this study. Three substitutions detected in PB2 and NS1 appeared to alter virus pathogenesis in mice, but had marginal impact when tested in ferrets. Furthermore, our data highlighted the necessity of monitoring the emergence of drug-resistant viruses during treatment of patients with NAIs. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P70 POSTE R A BSTRAC TS SPA3: IMMUNOLOGY SPA3P01 Back-boost of antibody landscapes after influenza virus infection or vaccination Fonville, Judith (1,2); Wilks, Sam (1,2); James, Sarah (1); Aban, Malet (3); Xue, Lumin (3); Jones, Terry (1,2); Ventresca, Mario (1); Fox, Annette (4); Nguyen Minh Hoa, Le (4); Quang Thai, Pham (5); Nhu Duong, Tran (5); Wong, Yan (1); Mosterin, Ana (1,2); Katzelnick, Leah (1,2); van der Net, Guido (6); Skepner, Eugene (1,2); Russell, Colin (2,7); Kaplan, Todd (8); Rimmelzwaan, Guus (6); Masurel, Nic (6); de Jong, Jan (6); Palache, Abraham (9); Beyer, Walter (6); Quynh Mai, Le (5); Tran Hien, Nguyen (5); Wertheim, Heiman (4); Hurt, Aeron (3); Osterhaus, Ab (6); Barr, Ian (3); Fouchier, Ron (6); Horby, Peter (4); Smith, Derek (1,2) 1: University of Cambridge, United Kingdom; 2: WHO Collaborating Center for Modeling, Evolution, and Control of Emerging Infectious Diseases, Cambridge, United Kingdom; 3: WHO Collaborating Centre for Reference and Research on Influenza, Melbourne, Australia; 4: Oxford University Clinical Research Unit and Wellcome Trust Major Overseas Programme, Hanoi, Vietnam; 5: National Institute of Hygiene and Epidemiology, Hanoi, Vietnam; 6: Department of Virology, Erasmus Medical Center, Rotterdam, the Netherlands; 7: Department of Veterinary Medicine, University of Cambridge, Cambridge; 8: bobblewire.com; 9: Abbott Laboratories, Weesp, the Netherlands Background We present a methodology that enables in-depth analyses of human serological data, which were previously difficult to interpret because of complex, and usually unknown, exposure histories, and cross-reactivity due to antigenic relatedness strains. This technique, Back-boost of antibody landscapes among after influenza virus infection or vaccinationwhich we call the antibody landscape, achieves a quantitative visualization and analysis of antibody-mediated immunity by accounting for antigenic variation among pathogen • Background: strains. Using this approach, we aim to improve our understanding of the typical characteristics of the human We present a methodology that enables in-depth analyses of human serological data, which were previously difficult to interpret because of complex, and usually unknown, exposure serological response to infection and vaccination. histories, and cross-reactivity due to antigenic relatedness among strains. This technique, which we call the antibody landscape, achieves a quantitative visualization and analysis of antibody-mediated immunity by accounting for antigenic variation among pathogen strains. Using this approach, we aim to improve our understanding of the typical characteristics of the human serological response to infection and vaccination. Methods The antibody landscape extends an antigenic map in an additional dimension, to show the serological titers, and • Methods: The antibody extends an antigenic map surface in an additional dimension, to show the we fitlandscape a representative smooth showing antibody levels for viruses from 43 years of influenza A/H3N2 virus serological titers, and we fit a representative smooth surface showing antibody levels for figure). Wevirus created landscapes for samples taken annually from 2007 to 2012 from 69 virusesevolution from 43 years(see of influenza A/H3N2 evolution antibody (see figure). We created antibody landscapes for samples taken annually from 2007 to 2012 from 69 unvaccinated individuals unvaccinated (born between 1917-2005) in Vietnam. Additionally, we created pre- and post-vaccination (born between 1917-2005) individuals in Vietnam. Additionally, we created pre- and post-vaccination antibody landscapes for 102 individuals antibody landscapes for 102 and individuals vaccinated A/Nanchang/933/95 in 1997, and 123 individuals vaccinated with A/Nanchang/933/95 in 1997, 123 individuals vaccinated with with A/Sydney/5/97 in 1998. vaccinated with A/Sydney/5/97 in 1998. Creating an antibody landscape. (A) Antigenic map of A/H3N2 showing virus strains color-‐coded by antigenic cluster. (B) An additional dimension indicates antibody titers as impulses, and a smooth surface is fitted using locally weighted multiple linear regression to create the antibody landscape. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P71 POSTE R A BSTRAC TS Creating an antibody landscape. (A) Antigenic map of A/H3N2 showing virus strains color-coded by antigenic cluster. (B) An additional dimension indicates antibody titers as impulses, and a smooth surface is fitted using locally weighted multiple linear regression to create the antibody landscape. Results We assessed the serological changes in the Vietnam cohort, and found antibody landscapes to be stable from one year to the next. Upon infection with A/H3N2, a back-boost was observed – an increase of antibodies across an individual’s prior subtype-specific immunity. We retrospectively compared two vaccination studies with similar prevaccination landscapes. As expected following a vaccine update, average vaccination responses were significantly greater against later antigenic clusters following vaccination with the antigenically advanced A/Sydney/5/97 virus. The back-boost following infection was also observed for the vaccination studies: the antigenically advanced vaccine virus showed similar or increased responses for across the complete antibody landscape. Conclusions Our results highlight underscore the importance of accounting for antigenic variation to better understand multiexposure sera, and provide a methodology for the direct visualization of otherwise complex serological patterns, allowing basic insights into the breadth of the adaptive humoral immune response. We found that a pre-emptive antigenic update of the vaccine has the dual advantage of being effective against the antigenically novel viruses to which they were targeted while remaining effective for contemporary viruses if they continued to circulate, which may improve influenza vaccine effectiveness in previously-exposed individuals. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P72 POSTE R A BSTRAC TS SPA3P02 Exposure history or immunosenescence –what determines the antibody response to influenza vaccine in elderly persons? Mosterín Höpping, Ana (1,4); McElhaney, Janet (2); Fonville, Judith (1,4); Beyer, Walter (3); Smith, Derek (1,4,3) 1: Centre for Pathogen Evolution, University of Cambridge, Department of Zoology, Downing Street, Cambridge, CB2 3EJ, UK; 2: Advanced Medical Research Institute of Canada, Sudbury, ON, P3E 5J1, Canada; 3: Erasmus MC, Department of Viroscience, Rotterdam, PB 2040, NL3000 CA Rotterdam, The Netherlands; 4: World Health Organization Collaborating Center for Modeling, Evolution, and Control of Emerging Infectious Diseases, Cambridge CB2 3EJ, UK Background Numerous studies have explored whether the antibody response to influenza vaccination in elderly adults is as strong as it is in young adults. Results vary, but tend to indicate lower post-vaccination titers (antibody levels) in the elderly supporting the concept of immunosenescence. Methods We conducted a four-year study of serial annual immunisations with inactivated trivalent vaccines in 135 young adults (16 to 39 years) and 105 elderly adults (62 to 92 years). None of the young had been vaccinated before entering the study, but just as in other studies the elderly adults had all been vaccinated against influenza before entering the study. This detailed panel dataset allowed us not only to investigate the effect of age, but to explain the apparent contradiction in results reported so far based on investigations at an aggregate level. Results In response to the first vaccination, young adults produced higher postvaccination titers than elderly adults for all three vaccine components. However, upon subsequent vaccinations the titer difference due to age declined rapidly, for example, from a nearly two-fold ratio at first vaccination to one-fold after three vaccinations for A/H3N2. Although age is an important factor when modeling the outcome of the first vaccination, this term lost relevance with successive vaccinations. In fact, when we examined the data with the assumption that the elderly group had received (on average) as few as two vaccinations prior to our study, the difference due to age disappeared. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P73 POSTE R A BSTRAC TS In our interpretation, the initial age group difference in post-vaccination titers is not due to immunosenescence, but is more parsimoniously explained by differing pre-study vaccination and infection histories. Since datasets underlying other published studies are also affected by a difference in vaccination and infection history between age groups, this interpretation may also explain the discrepancy between results reported. Figure 1 Post-vaccination antibody levels for different age classes – notice there is a difference in post-vaccination titres between, but not within the two age groups. Table 1 Independent variables Age Estimates of regression model A (y-intercept) BAge 2 R Old adults Young adults All 3.330* 0.005 (P=0.489) 0.001 4.319* 0.002 (P=0.747) 0.000 4.579* -0.021 (P=0.000) 0.076 Summarized results of the regression post-titre = A+ BAge* Age for each of the two age groups, and for the combined dataset. Notice that age only has a predictive effect in the combined dataset and not within either age group. Table 2 Independent variables Estimates of regression model Pre-titre Age group A (y intercept) B pre B agegroup 2 R ** p<0.01 Number of vaccinations (NV) Total 2.43*** 0.60** 1 3.54*** 0.65*** -1.46*** 0.29 *** p<0.001 2 2.36*** 0.60*** -0.43** 0.42 3 1.79*** 0.68*** -0.16 0.46 4 1.04*** 0.84*** 0.075 0.73 Regression analysis predicting post-titre, by pre-titre and excluding or including age group, by number of vaccinations. Notice that the significance for age-group declines with number of vaccinations, until agegeoup is small, insignificant and changes sign. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P74 POSTE R A BSTRAC TS SPA3P03 Serodiagnostic studies during the development of new pandemic caused A(H1N1)pdm09. Mukasheva, Evgeniya (1); Kolobukhina, Ludmila (1); Kisteneva, Lidiya (1); Zaplatnikov, Andrey (2); Smolonogina, Tatyana (3); Desheva, Yuliya (3); Burtseva, Elena (1) 1: D.I.Ivanovsky Research Institute of Virology, Russian Federation; 2: Russian Medical Academy of Postdegree Education, Russian Federation; 3: Institute of Experimental Medicine of the NorthWest Branch of the Russian Academy of Medical Sciences, Russian Federation Background The aim of this study was to identify the features of the production factors of humoral immunity in response to infection by new pandemic influenza A(H1N1)pdm09 virus among persons with different epidemiological anamnesis. Materials and methods. Paired sera from 203 patients hospitalized with ILI symptoms (2009-2011) including pregnant women, single sera from 287 schoolchildren living in boarding school in Moscow (2009), single sera from 83 pregnants and 20 newborns aged 1 day (2010), collected by staff Medical University named after V.I. Razumovsky, Saratov (March-April 2010) were included in study. To detect of specific influenza virus A(H1N1)pdm09 RNA in nasopharyngeal swabs from hospitalized patients RT-PCR in real-time using commercial test kits was used. The level of specific antibodies to hemagglutinin (anti-HA) and neuraminidase (anti-NA) and their dynamics were studied in HI and solid state reaction inhibiting neuraminidase activity accordingly. Results The 4-fold and higher dynamics of the anti-HA antibodies was detected among A(H1N1)pdm09 positive by RT-PCR hospitalized patients (28,6% among all patients and 14,0% – in pregnants); meantime in patients with A(H1N1) pdm09 negative by RT-PCR these indexes were much lower (16,7% and 11,0% accordingly), but suggested A(H1N1) pdm09 infection among them as additional diagnostic measures. Also 4-fold and higher dynamics of the anti-HA antibodies to seasonal influenza A(H1N1) virus was found in these patients as well, meantime the active circulation of it was not detected during studied period: among RT-PCR-positive – 22,4% and 14,0% accordingly; among RT-PCRnegative – 16,7 and 11,0% accordingly. Positive dynamics against strains of influenza virus A(H3N2) and B in the sera was not detected. The results of screening sera from schoolchildren living in boarding school showed that by March 2010 the most children (78%) have acquired specific antibodies to A(H1N1)pdm09. The transfer of maternal antibodies to babies, including antibodies to the pandemic strain of influenza A(H1N1)pdm09 virus was found as well. The results of this study showed that the immune response to hemagglutinin and neuraminidase (anti-HA and anti-NA), as a result of natural infection by influenza A(H1N1)pdm09 virus, is formed simultaneously in more than half of hospitalized patients: 57,7% – among all patients and 55,6% – pregnants. Conclusions Our results showed that during the first (2009-2010) and the second (2010-2011) wives of new pandemic caused by influenza A(H1N1)pdm09 virus, population had different risk and time to have “contact” with this virus. It was important to use serological tests to confirm influenza infection in RT-PCR-negative patients and confirm the transfer the maternal antibodies to A(H1N1)pdm09 to newborn babies. Also the simultaneously forming of anti-HA and anti-NA to A(H1N1)pdm09 in more then 50,0% hospitalized patients was found. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P75 POSTE R A BSTRAC TS SPA3P04 Avian myotubes are highly susceptible to influenza virus infection and replication Chang, Kin-Chow (1); Baquero-Pereza, Belinda (1); Kuchipudi, Suresh V. (1); Ho, Jemima (1); Sebastian, Sujith (1); Brookesb, Sharon, M. (2); Brownb, Ian H. (2) 1: School of Veterinary Medicine and Science, University of Nottingham, Sutton Bonington Campus, College Road, Loughborough, Leicestershire LE12 5RD, UK.; 2: Virology Department, Animal Health Veterinary Laboratories Agency Weybridge, Addlestone, Surrey KT15 3NB, UK. Background Skeletal muscle can potentially play an important role in the transmission of highly pathogenic avian influenza (HPAI) H5N1 viruses as demonstrated by their isolation from infected poultry. Furthermore, infection with HPAI H5N1 viruses in ducks is often asymptomatic and meat from such birds could be a source of infection to humans, either through handling or consumption of infected raw or undercooked meat. Little is known about the replication of avian influenza viruses in avian skeletal muscle cells. To this end we used primary chicken and duck multinucleated myotubes to examine the cyto-pathogenicity and corresponding host innate immune response to influenza virus infection. Methods. Cytopathological effects of a low pathogenicity avian influenza (LPAI) H2N3 [A/mallard duck/England/7277/06] and two HPAI H5N1 viruses [A/turkey/England/50-92/91 and A/turkey/Turkey/1/05, referred to as HPAI H5N1 5092 and HPAI H5N1 tyTy05 respectively], in primary chicken and duck muscle cells [myotubes and myoblasts] and in relation to Madin-Darby canine kidney (MDCK) cells were examined, which included the determination virus replication, relative cell viability, apoptotic changes and host innate immune response. Results We found that chicken and duck cultured myotubes were highly susceptible to infection with both LPAI and HPAI viruses. Chicken and duck myotubes expressed both avian and human sialic acid receptors, and rapidly accumulated viral nucleoprotein and M-gene RNA. Subsequent progeny virus release was accompanied by extensive cytopathic damage of myotubes with hallmarks of apoptosis (widespread microscopic blebs, caspase 3/7 activation and annexin-V binding at plasma membrane). Infected chicken myotubes produced significantly higher proinflammatory cytokines than corresponding duck cells. Additionally, in H5N1 virus infected chicken myotubes, IFN-β and interferon-inducible genes, including MDA5, were down-regulated in contrast to corresponding H2N3 virus infection. Conclusions Our findings indicate that avian skeletal muscle is a major amplification site for HPAI H5N1 virus replication, highlighting the importance of skeletal muscle in the pathogenicity and transmission of virulent influenza virus infection. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P76 POSTE R A BSTRAC TS SPA3P05 Investigating B and T cell repertoire signatures in response to influenza infection Lu, I-Na; Farinelle, Sophie; Muller, Claude P. Laboratory of Immunology, Centre de Recherche Public de la Santé (CRP-Santé), Luxembourg Background The adaptive immune system provides protection against an enormous variety of pathogens. This protection is mediated by receptors on the surface of B and T cells that bind to pathogen derived antigens. Methods. Using a model of murine influenza A virus infection, humoral and cellular immune responses are evaluated by enzyme-linked immunosorbent assay (ELISA), enzyme-linked immunospot (ELISpot) assay, and flow cytometry. B and T cells from different organs (spleens, lymph nodes, bone marrows) are isolated applying magnetic-activated cell sorting (MACS) technology. Next generation sequencing, such as the semiconductor-based Ion Torrent sequencing platform, is used to investigate the B and T cell repertoire signatures. Results Influenza virus infection induces robust B and T cell responses. These responses are directed against immunodominant surface structures that continuously undergo genetic changes such as the hemagglutinin protein, a major target of neutralizing antibodies. The pathogenesis of influenza virus and the nature of the antiviral B and T cell responses drive changes in repertoire diversity as the main mechanism of the influenza specific immunity. Here, we study the B and T cell repertoire in response to influenza A virus in multiple organs and time points in order to clarify the developmental evolution of the protective repertoire signatures. Conclusions This analysis of B and T cell repertoire signatures in response to influenza infection can provide important clues for the design of successful vaccines and vaccination approaches. Keywords: influenza; B cell repertoire; T cell repertoire TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P77 POSTE R A BSTRAC TS SPA3P06 Influenza virus infection in quail (Coturnix coturnix): characterization of humoral immune response Majo, Natalia (1,2); Busquets, Núria (1); Garcia, Beatriz (1); Bensaid, Albert (1); Dolz, Roser (1); Oliver, Salvador (1); Bertran, Kateri (1); Ramis, Antoni (1,2); Rivas, Raquel (1) 1: Centre de Recerca en Sanitat Animal (CReSA), Spain; 2: Facultat de Veterinaria, Universitat Autònoma de Barcelona Since quail have emerged as a potential intermediate host in the spread of avian influenza viruses (AIV), new efforts have been made to clarify the epidemiologic role of this species in avian influenza infection. In this study, we sought to better understand the immune response generated by different influenza virus in quail. An experimental infection with a low pathogenic avian influenza virus (LPAIV) H5N2 and a human H1N1 (pH1N1) virus were conducted in quail to evaluate the humoral immune response, at both systemic and local levels. Forty-eight quails were divided into three groups housed in independent isolation units at the biosafety level 3 (BSL-3) facilities of CReSA. Birds on group 1 (G1; n=20) were inoculated with H5N2 LPAIV (106EID50/50μL), birds on group 2 (G2; n=20) were inoculated with pH1N1 (106EID50/50μL) and birds on group 3 (G3; n=8) were inoculated with saline solution; thus served as a negative control. Five animals of each infected group and two animals of the control group were euthanized at 3, 6, 10 and 12 days post-inoculation (dpi). Blood, choanal, tracheal and cloacal swab samples were collected. Blood was used to evaluate seroconversion and antibodies isotype dynamics by competition ELISA (cELISA). Swabs were used to study viral shedding by quantitative RT-PCR and total antibodies at local level by cELISA. Direct ELISA tests were performed in order to determine if quail antibodies could be recognized by commercial antibodies against chicken antibodies. Quail supported the replication of H5N2 subtype, therefore, seroconversion was present in H5N2 infected animals. On the contrary, only one bird belonging to G2 group (pH1N1) showed viral shedding on both choanal and tracheal swabs at 3 dpi and they did not show seroconversion. Anti-chicken goat IgG polyclonal antibodies recognized IgY and IgM quail antibodies in serum. Quail IgM isotype antibodies against influenza nucleoprotein (NP) were found in serum samples from H5N2 infected quails with a strong humoral immune response. Moreover, total antibodies against NP were detected in swab samples from one animal belonging to H5N2 infected group at 12 dpi. Most of the animals inoculated with H5N2 LPAIV were capable to develop a humoral immune response in front of the infection. These data correlate well with the replication capability of the viruses tested. We demonstrated that anti-IgY and IgM chicken antibodies cross-reacted with quail antibodies and they can be used for serological studies in quails. In H5N2 infected animals, IgM isotype antibodies could be detected as early as 6 dpi and a poor response by IgY isotype antibodies was detected, indicating that the days sampled in this experimental infection were too early to detect them effectively. Work funded by Spanish National Institute for Agricultural and Food Research and Technology (INIA) (RTA201100111-C03). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P78 POSTE R A BSTRAC TS SPA3P07 Humoral and cellular immune responses following the 2009 pandemic Oftung, Fredrik (1); Korsvold, Gro Ellen (1); Dembinski, Jennifer (1); Tunheim, Gro (1); Savic, Miloje (1); Kristoffersen, Anne Cathrine (1); Haneberg, Bjørn (1); Germundsson Hauge, Anna (1); Kim, Yohan (2); Peters, Bjoern (2); Berdal, Jan Erik (4); Monceyron Jonassen, Chrstine (3,4); Mjaaland, Siri (1,5) 1: Norwegian Institute of Public Health, Oslo, Norway; 2: La Jolla Institute for Allergy and Immunology, California, USA; 3: Østfold Hospital Trust, Norway; 4: Akershus University Hospital, Norway; 5: KG Jebsen Centre for Research on Influenza Vaccines Background Whereas humoral immunity confers protection against infection with influenza viruses through strain-specific antibodies, recent findings suggest a major role of cross-reactive CD4 and CD8 T cells for protection against heterotypic influenza infections by various effector mechanisms. In this study, we have characterized immune responses following infection with the pH1N1 virus during the first wave of the 2009 pandemic. Methods. Serum, nasal secretions, and PBMC were collected from outpatients with laboratory confirmed pH1N1 virus 3 weeks and 7 months after infection. Clinical parameters were recorded for all patients. Hemagglutination inhibition (HI) assay, micro-neutralization (MN) assay, and ELISA against pH1N1 and two seasonal strains (NewCal/99/H1N1 and Brisbane/H3N2) were performed on serum samples, whereas nasal secretions were only analyzed by ELISA. Cellular immune responses were measured by IFN-γ ELISPOT assays using the same viral strains and selected peptide pools representing known CD4 and CD8 epitopes from both surface and internal antigens. Results The HI and MN antibody titers correlated well. The titers against pH1N1 were significantly higher than for the seasonal viruses, and all antibody levels declined over time. In contrast, the IgG antibody levels in serum and nasal secretions measured by ELISA did not differentiate between pandemic and seasonal virus strains. IFN-γ ELISPOT analysis of T cell responses showed cross-reactivity for pH1N1 virus and the two seasonal strains tested at both time points. When analyzing the responses by using pools of common CD4 and CD8 peptide epitopes, we observed a significant response against epitopes from conserved antigens, but not from surface antigens (HA and NA). Moreover, the donors also responded to sets of peptides representing CD4 and CD8 epitopes unique to pH1N1 antigens. Conclusions In contrast to antibody responses against surface antigens, T cell responses involving both CD4 and CD8 subsets are directed against sets of conserved epitopes common for both seasonal and pandemic influenza strains. The results highlight that cross-reactive cellular immunity involving both subsets of T cells may be important for protection against pandemic disease in the absence of strain-specific antibodies. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P79 POSTE R A BSTRAC TS SPA3P08 Contribution of single mutations specific for A/Leningrad/134/17/57 (H2N2) master donor virus in influenza A virulence and immunogenicity in a mouse model Petukhova, Galina; Kuznetsova, Svetlana; Losev, Igor; Isakova-Sivak, Irina; Kuznetsova, Victoria; Korenkov, Daniil; Rudenko, Larisa; Naykhin, Anatoly Institute Of Experimental Medicine RAMS, Russian Federation Background Live attenuated influenza vaccines (LAIVs) are able to provide protection by inducing significant mucosal and cell-mediated immune responses. Vaccine strains for LAIV have temperature-sensitive (ts), cold-adapted (ca) and attenuated phenotypes which are guaranteed by the presence of specific mutations in internal genes of A/ Leningrad/134/17/57 (Len/17) master donor virus (MDV). However it is known that the process of attenuation can affect immunogenicity of live influenza viruses. Thus, study of the impact of single mutations in MDV on the virulence of attenuated strains and immune response is necessary for better understanding of the LAIV immunogenicity mechanisms. Methods. We used 11 reverse genetics–derived mutant viruses based on wild-type A/Leningrad/134/57 (H2N2) virus (Len/134): nine single mutant reassortants (SMRs) carrying one MDV-specific mutation in the Len/134 background (PB1-K265N, PB1-V591I, PB2-V478L, PA-L28P, PA-V341L, NP-N492S, M1-I15V, M1-F144L, NS2-M100I); and Len/134 and Len/17 as control viruses. Ts phenotype of the viruses was determined by plaque assay in MDCK cells at 33°C, 37°C and 38°C. All mutants were intranasally inoculated into CBA female mice at a dose of 5,5 log10TCID50. Lungs and nasal turbinates (NT) were collected at 3 dpi and infectious virus titers were determined by titration of organ homogenates in eggs. Antibodies against whole Len/134 wt virus in mouse sera were analyzed at 28 dpi by HAI assay and ELISA. Results None of single mutations affected virus replication in MDCK cells at 37°C, whereas PB2-V478L and PB1-K265N mutations had significant impact on virus ts phenotype at 38°C. Nevertheless, these two viruses replicated in mouse lungs to the same level as Len/134 wt virus. Surprisingly, mutations in M1 gene had significant impact on virus reproduction profile in mice: I15V mutation reduced virus titer in lungs whereas F144L change enhanced virus replication in NT. Therefore no correlation was observed between ts phenotype and virus titers in lungs and/ or NT of these SMRs. Mutations PB1-K265N, PB1-V591I and NP-N492S slightly reduced HAI antibody titers at 28 dpi, whereas PB2-V478L, PA-L28P, M1-I15V and M1-F144L substitutions enhanced virus immunogenicity if compared to the control Len/134 virus, and the strongest effect was noted for PB2-V478L SMR. Combination of all tested mutations resulted in the most attenuated and least immunogenic virus if measured by HAI and ELISA. HAI titers correlated well with ELISA study of serum virus-specific IgG levels. Conclusions Most of single MDV-specific mutations do not affect virus replication in mouse respiratory organs with the exception of mutations in M gene. Some mutations are able to increase or decrease virus-specific antibody levels in mouse sera. Further studies of local humoral and cellular immune responses of these viruses in the mouse model will provide additional data on the mechanisms involved in the immunogenicity of LAIV. This work was supported by RFBR Grant No 14-04-32250. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P80 POSTE R A BSTRAC TS SPA3P09 Antibody response against unchanged influenza vaccine components in elderly people vaccinated in consecutive years Basileo, Michela (1); Iorio, Anna Maria (1); Bartolini, Guido (2); Tozzi, Paolo (3); Camilloni, Barbara (1) 1: Dept. Exp. Med. University of Perugia, Italy; 2: Opera Pia B. Castori, Foligno, Italy; 3: Azienda USL2, Foligno, Italy Background Annual influenza vaccination is recommended for high risk groups because of the frequent mutations of influenza viruses and the rapid decline of vaccine induced antibody titers. Field studies demonstrated that annually repeated vaccination is efficacious in reducing morbidity and mortality. Serologic studies, however, showed divergent results on the induction of protective antibodies after annually repeated vaccination and a decline of immune antibody response was observed especially in the years when vaccine strains did not change. To further assess the effect of annual vaccination we studied, over 16 consecutive seasons, from 1998/99 to 2013/14, the haemagglutination inhibiting (HI) antibody response of elderly institutionalized yearly vaccinated volunteers against vaccine antigens which for sequential years were not changed. Methods. The volunteers enrolled were elderly institutionalized people aged >60 years, annually vaccinated for influenza. HI titers were determined in serum samples taken before and 1 month after vaccination by a standard microtiter method. Differences in HI titers were analyzed by Student’s t-test for continuous statistics, and by chi-square test for qualitative statistics. Results HI antibody responses were studied in 6 cohorts of volunteers against vaccine antigens not changed in consecutive years. Responses against A/H1N1 antigens were examined in 16 subjects against A/New Caledonia/20/99 for 7 consecutive years (from 1998/99 to 2006/07), and in 36 subjects against A/California/7/09 for 4 years (from 2010/11 to 2013/14). Against A/H3N2 antigens 38 subjects were examined against A/Moscow/10/99 for 4 years (from 2000/01 to 2003/04). Responses for B antigens were studied in 51 subjects against B/Beijing/184/93 for 3 years (from 1998/99 to 2000/01), and in 41 subjects against B/Brisbane/60/08 for 3 years (from 2009/10 to 2011/12). The pre-vaccination HI antibody titers found after the first year of administration tended to be higher for A/H3N2 and B/Brisbane antigens and similar or slightly lower for the two A/H1N1 and for B/Beijing antigens. The postvaccination values observed in the sequential years were in general similar for B/Beijing, slightly lower for the two A/H1N1 antigens and higher for B/Brisbane and A/H3N2 strains. The vaccine-induced HI antibody response against the different antigens studied was substantially positive, comparing pre- and post-vaccination sera, the increases in HI antibody titers resulted in most instances statistically significant. The requirements of the European Commission were satisfied more frequently in the early years of administration with the exception for the B antigens. Conclusions The results obtained confirm the complexity of antibody induction in sequential annual influenza vaccination. Although we cannot exclude other mechanisms, our data seem to support the possibility of an impairment of antibody response against unaltered influenza A/H1N1 antigens that have circulated for prolonged periods whereas the responses against the A/H3N2 and B vaccine strains, more frequently changed, tended to be similar or higher. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P81 POSTE R A BSTRAC TS SPA3P10 Searching for a universal biomarker of human T-cell responses to Influenza A virus infections Dembinski, Jennifer Lynn (1,3); Oftung, Fredrik (1,3); Savic, Miloje (1,3); Kim, Yohan (2); Peters, Bjoern (2); Mjaaland, Siri (1,3) 1: Department of Bacteriology and Infection Immunology, Norwegian Institute of Public Health, Oslo, Norway; 2: La Jolla Institute for Allergy and Immunology, La Jolla, CA, USA; 3: KG Jebsen Centre for Influenza Vaccine Research, Oslo, Norway Background The currently used split and subunit influenza vaccines induce antibody mediated immunity effective in protecting against homologous influenza strains, but do not protect well against heterologous strains. The lack of robust cell mediated responses is due to the lack of conserved epitopes in the vaccine. We aim to optimize influenza vaccination and pandemic preparedness strategies by identifying conserved T-cell epitopes which have broad cross reactivity against a range of seasonal and pandemic strains. The goal of the study was to develop a set of peptide defined epitopes to be used as an efficient tool for monitoring Influenza A T-cell responses in the context of universal vaccine development. Methods. Both MHC class I and class II restricted T-cell responses are based on the recognition of small peptide fragments after antigen processing. Using this as a basis for prediction, we have defined a set of synthetic peptides using the Immune Epitope Database (www.iedb.org). Scoring of the peptide candidates was calculated using parameters such as epitope conservancy, prevalence, and HLA supertype coverage, and optimal sets of epitopes were defined by using a greedy algorithm. A total of 33, 31, 14 or 5 peptides were selected which represent the general influenza CD4 or CD8 epitope library or the 2009 pandemic specific CD4 or CD8 epitope library respectively. These libraries consist of peptides which represent CD4 and CD8 epitopes from conserved (internal viral proteins) and variable (external viral proteins) antigens. PBMCs were stimulated in vitro by the various peptide libraries to assess cellular immune responses (cytokine expression) as measured by Elispot, multiplex and multiparameter flow cytometry. Results Utilizing available biobanks at the Norwegian Institute of Public Health, we evaluated cellular immune responses from donors based on vaccination or infection history, and found that the peptides function well in detecting both CD4 and CD8 responses in people with varying medical histories. When evaluating healthy donors, the CD4/ CD8 epitopes from the conserved antigens were more frequently recognized than the CD4/CD8 epitopes from the variable antigens after stimulation by either the general or 2009 pandemic specific peptide libraries. We are currently evaluating the peptides using PBMCs from donors based on previous vaccination and/or illness history in those with confirmed seasonal or 2009 pandemic influenza infections. Conclusions By creating pooled peptide libraries, we are able to define more precise immune responses than from using whole virus as antigenic stimulation. Peptide libraries may be a useful tool to monitor the efficacy of national vaccination programs and clinical trials for the development of a universal influenza vaccine, as well as the immune status of populations to predict pandemic preparedness. Taken together, we are optimistic that a universal influenza vaccine is an achievable goal. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P82 POSTE R A BSTRAC TS SPA3P11 LPS-modified outer membrane vesicle (fmOMV) adjuvant provides protective innate immunity against influenza infection prior to the induction of vaccine-induced adaptive immune response Bae, Eun Hye; Lee, Tae Young; Lee, Sang Ho; Yeom, Min Joo; Na, Woon Seong; Kim, Chang Ung; Song, Dae Sub; Kim, Doo Jin; Kim, Sang Hyun Korea research institute of bioscience and biotechnology, Korea, Republic of (South Korea) Background Outer membrane (OM) vesicles, naturally produced by Gram-negative bacteria, have important roles in bacterial pathogenesis. It is also well known that OM vesicles can stimulate the host innate immune system through the activation of toll like receptor (TLR) signaling pathways. Previous studies have revealed that TLR agonists can trigger the innate immune response in the lung and protect against influenza infection. Therefore, it is shown to be a good strategy to limiting the replication of influenza infection by innate immune response. Methods. C57BL/6 mice were intranasally administrated fmOMV(10ug) at various times (3, 7 or 14 days). Pre- treated mice were then infected with 10MLD50 influenza A virus strain A/California/04/2009 (CA/04, H1N1 subtype) virus or A/Puerto Rico/8/34 (PR8, H1N1 subtype) virus by aerosol and monitored for survival. Lung tissues were collected to determine virus titers and to analyses immune cellular responses using multiparameter flow cytometry. The cytokine and chemokine analysis were measured by the multiplex cytokine assay. Results In this study, we investigated the immunostimulatory effect of LPS-modified OM vesicle (fmOMV) in mice, as well as the efficacy of fmOMV as an antiviral agent against influenza virus infection. Intranasal administration of fmOMV dramatically enhanced the survival rate against lethal influenza A virus challenge. The protective immunity maintained for a week. More importantly, pre-treatment of fmOMV conferred broad protection against different influenza virus strains, while the vaccination provided only strain-specific immunity. fmOMV also significantly increased the level of proinflammatory cytokines such as IL-6, RANTES, IL-1β, and TNF-α in the airway lumen, and the neutrophil recruitment into the lungs. Conclusions These data suggest that fmOMV induces robust activation of innate immunity in the lungs and can be used as an effective antiviral agent against influenza viruses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P83 POSTE R A BSTRAC TS SPB3: MATHEMATICAL MODELING SPB3P01 Mortality Associated with Seasonal and Pandemic Influenza among Pregnant and Non-Pregnant Women of Childbearing Age in a High HIVPrevalence Setting – South Africa, 1999-2009 Tempia, Stefano (1,2,3); Walaza, Sibongile (3); Cohen, Adam (1,2); von Mollendorf, Claire (3); Moyes, Jocelyn (3,4); Mhlanga, Sarona (3); McAnerney, Johanna (3); Cohen, Cheryl (3,4) 1: Influenza Division, Centers for Disease Control and Prevention, Atlanta, Georgia, United States of America; 2: Influenza Division, Centers for Disease Control and Prevention, Pretoria, South Africa; 3: Center for Respiratory Diseases and Meningitis, National Institute for Communicable Diseases of the National Health Laboratory Service, Johannesburg, South Africa; 4: Faculty of Health Sciences, University of the Witwatersrand, School of Public Health, Johannesburg, South Africa Background Information on the mortality burden associated with seasonal and pandemic influenza virus infection among pregnant women is scanty in most settings, particularly in sub-Saharan Africa where pregnancy rates and HIV prevalence are elevated. Methods We estimated the seasonal and A(H1N1)pdm09 influenza-associated mortality among pregnant and non-pregnant women of childbearing age (15-49 years of age) from 1999 through 2009 in South Africa, using national vital statistics data coded according to the International Classification of Diseases, Tenth Revision, adjusting for maternal deaths underreporting. We modeled the excess mortality attributable to influenza infection by applying Poisson regression models to monthly all-cause deaths among pregnant and non-pregnant women, using national influenza laboratory surveillance data as covariates. Since the diagnosis of AIDS is rarely coded on the death certificate, we indirectly estimated the annual influenza-associated deaths among HIV- infected and -uninfected pregnant and non-pregnant women using Poisson regression models that incorporated year- and pregnancy status-specific HIV prevalence and highly active antiretroviral treatment coverage as covariates. Mortality rates were expressed per 100,000 person-years. Because of the important differences in the age distribution of pregnant and non-pregnant women of childbearing age, we used indirect standardization (using non-pregnant women as the standard population) to compare the influenza- associated mortality rates between pregnant and non-pregnant women. Results During 1999-2009 the mean annual seasonal influenza-associated mortality rates were 12.6 (123 deaths) and 7.3 (914 deaths) among pregnant and non-pregnant women, respectively. Among pregnant women the mean annual seasonal influenza-associated mortality rates were 74.9 (109 deaths) and 1.5 (14 deaths) among HIV-infected and – uninfected individuals, respectively. Among non-pregnant women the mean annual seasonal influenza-associated mortality rate was 41.2 (824 deaths) among HIV-infected and 0.9 (90 deaths) among HIV–uninfected individuals. Pregnant women experienced an increased risk of seasonal influenza-associated mortality compared to nonpregnant women (HIV-adjusted and age-standardized relative risk [RR]: 2.8; 95% confidence intervals [CI]: 2.1-3.7). In 2009 the influenza A(H1N1)pdm09-associated mortality rates were 19.3 (181 deaths) and 9.4 (1189 deaths) among pregnant and non-pregnant women, respectively (age-standardized RR for influenza A(H1N1)pdm09-associated mortality due to pregnancy: 3.2; 95% CI: 2.3-4.1). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P84 POSTE R A BSTRAC TS Conclusions Among women of childbearing age, the majority of seasonal influenza-associated deaths occurred among HIVinfected individuals. Pregnant women experienced an increased risk of death associated with seasonal and pandemic influenza infection compared to non-pregnant women. While the number of influenza A(H1N1)pdm09associated deaths was higher compared to seasonal influenza the relative risk of influenza-associated mortality because of pregnancy was similar for seasonal and pandemic influenza. This suggests that the elevated number of influenza A(H1N1)pdm09-associated deaths observed among pregnant women in 2009 may be due to the observed heavy burden of the pandemic virus among adolescents and young adults, the age group where the majority of pregnancies occur. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P85 POSTE R A BSTRAC TS SPB3P02 The relationship between school holidays and transmission of influenza in England and Wales 1967-2008 Jackson, Charlotte (1,2,3); Vynnycky, Emilia (1,2); Mangtani, Punam (1) 1: Public Health England, United Kingdom; 2: LSHTM; 3: UCL Background School closures is often considered as a possible intervention during influenza outbreaks, but its effects on transmission are poorly understood, partly because data on how school closures affect contact patterns are limited. Previous modelling studies have provided insight into the relationship between the school calendar and transmission of influenza in settings such as France and The Netherlands, but it is unclear whether similar relationships exist elsewhere. Methods An age-structured susceptible-infectious-recovered (SIR) model was fitted to GP consultation data for influenzalike illness, amongst 0-14 year-olds and ≥15 year-olds, in England and Wales, 1967-2008. Each influenza season, defined to run from week 40 of one year to week 39 of the next, was analysed separately. Estimated parameters for each season included the contact parameters (the per capita rates of effective contact within and between age groups) and the relative change in the contact parameter representing contact between 0-14 year-olds comparing school holidays to termtime. 95% confidence intervals were calculated as the central 95% of estimates obtained by fitting the model to 1000 bootstrap datasets generated with weekly case numbers sampled from a Poisson distribution with mean equal to the reported number for that week. The infectious period was assumed to be 3.5 days. In sensitivity analyses, we explored the effect of assuming that the infectious period was 2 or 4 days. Estimates of the relative difference in the contact parameter during holidays compared to termtime were compared, using the correlation coefficient, to those obtained from a simple mass action model which estimated weekly contact parameters directly from the data for 5-14 year-olds. The agreement between the two estimates in the sign of the change in the contact parameter was assessed using the kappa statistic. Results The estimated percentage difference in the contact parameter amongst 0-14 year-olds during holidays compared to termtime ranged from a reduction of 100% (95% CI 88-100%) to an increase of 41% (95% CI 17% decrease to 50% increase). In >50% of the years considered, the contact parameter was estimated to be lower during holidays than during termtime, with a 95% CI excluding zero. These estimates were insensitive to the assumed duration of infectiousness. The correlation coefficient between the estimated difference in the contact parameter during holidays compared to termtime from the age-structured model and that from the simple mass action model was 0.47 (95% CI 0.16-0.70). The kappa statistic for the agreement between the signs of the estimates was 0.44 (p=0.005). Conclusions School holidays can be associated with reductions in transmission of influenza amongst school-aged children in England and Wales, although this was not consistent. School closure may reduce transmission during an influenza pandemic. Reasons for the variability in the yearly estimates should be investigated. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P86 POSTE R A BSTRAC TS SPB3P03 A drug-disease model to investigate the effect of combination therapy with oseltamivir on influenza virus progression Kamal, Mohamed A (1); Gieschke, Ronald (2); Lemenuel-Diot, Annabelle (2); Beauchemin, Catherine AA (3); Smith, Patrick F (4,5); Rayner, Craig R (4,6) 1: Department of Clinical Pharmacology, Roche Translational Clinical Research Center Inc., New York, NY, USA; 2: F.Hoffmann-La Roche Ltd, Basel, Switzerland; 3: Department of Physics, Ryerson University, Toronto, Canada; 4: d3 Medicine LLC, Parsippany, NJ, USA; 5: School of Pharmacy and Pharmaceutical Sciences, University at Buffalo, Buffalo, NY, USA; 6: Monash Institute of Pharmaceutical Sciences, Melbourne, Australia Background A population drug-disease model was developed to describe the time course of influenza virus with and without oseltamivir treatment. Methods Data included viral titres from 219 subjects across four studies who received placebo and oseltamivir 20–200 mg twice daily for 5 days. A three compartment mathematical model consisting of target cells infected at rate β, free virus produced at rate p and cleared at rate c, and infected cells cleared at rate δ was implemented in NONMEM with an inhibitory Hill function on virus production (p) accounting for the effect of oseltamivir (Figure 1). Results In congruence with clinical data, the model predicts that the standard 75 mg regimen initiated 2 days after infection decreased the duration of viral shedding by 1.5 days compared with placebo; the 150 mg regimen decreased shedding by an additional 0.25 days. The model also predicts that initiating oseltamivir therapy more rapidly postinfection, specifically at Day 0.5 or 1, results in proportionally greater decreases in duration of viral shedding – 5 and 3.5 days, respectively (Figure 2). Furthermore, the model suggests that combining oseltamivir (acting to subdue virus production rate) with an antiviral whose activity decreases viral infectivity (β) results in a moderate additive effect dependent on therapy initiation time (Figure 2). In contrast, the combination of oseltamivir with an antiviral whose activity increases viral clearance (c) shows significant additive effects independent of therapy initiation time. Conclusions The utility of the model for investigating pharmacodynamic effects of novel antivirals alone or in combination on emergent influenza strains warrants further investigation. Figure 1. Simple mechanistic model describing influenza virus progression. Figure 1. Simple mechanistic model describing influenza virus progression. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P87 Figure 2. Simulations predicting the combined in vivo pharmacologic effect on influenza POSTE R A BSTRAC TS viral dynamics with standard 75 mg twice daily oseltamivir therapy of decreasing viral production, p, decreasing infection rate, β, increasing viral clearance rate, c, and Figure 2. Simulations predicting the combined in vivo pharmacologic effect on influenza viral dynamics with standard rate δ of infected cells. Treatment started at 0.5, 1, 2 and days 75increasing mg twiceclearance daily oseltamivir therapy of decreasing viral production, p, 3decreasing infection rate, β, increasing viral clearance rate, Solid c, and increasing rate δ of effect infected cells. Treatment after infection. lines depict theclearance single pharmacologic of oseltamivir 75 mg started at 0.5, 1, 2 and 3 days after infection. Solid lines depict the single pharmacologic effect of oseltamivir 75 mg twice daily for 5 days. Dashed lines twice daily for 5 days. Dashed lines show combined pharmacologic effects. All show combined pharmacologic effects. All secondary effects were changed 10-fold from baseline. secondary effects were changed 10-fold from baseline. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P88 POSTE R A BSTRAC TS SPB3P04 Dynamic modeling of the cost-effectiveness of sick leave practices for influenza illness Edwards, Christina Hansen (1); de Blasio, Birgitte Freiesleben (1,2); Scalia Tomba, Gianpaolo (3) 1: Norwegian Institute of Public Health, Norway; 2: Dept. of Biostatistics University of Oslo, Norway; 3: Dept. of Mathematics, University of Rome, “Tor Vergata”, Italy Background Sick leave from work can contribute to reduce the number of cases of influenza in workplaces and in society. During the 2009 influenza pandemic, recommendations on sickness absence were issued in several European countries, but the net economic benefit of different recommendations has to our knowledge not been studied. We tested the effectiveness of interventions promoting early withdrawal from work after symptom onset, and/or higher proportion of work absence during illness (compliance) on reducing the health and economic burden of influenza in a realistic simulation model of influenza spread based on real interview data. Methods We developed an age-structured SEIR compartmental model representing both seasonal (R_eff = 1.1-1.3) and pandemic (R_0=1.2-1.6) influenza transmission. We calibrated the model to Norwegian data on work absence during ILI illness and country- specific estimates of mixing in work places, schools, general population and at home. Different scenarios were considered by varying i) level of compliance (65-90%), ii) delay in compliance following symptoms (0.5-2 days), iii) proportion of symptomatic adults (25%-55%) and iv) transmissibility. The analysis was performed from a societal perspective and the most effective was computed using a net benefit approach. Results Under base case assumptions (65% compliance, fully effective from day 4 after symptoms), the clinical attack rates (AR) ranged from 0.7-13.2% in seasonal epidemics to 4.3-29.5% in pandemics. The number of avoided cases was found to increase with the transmissibility. In a pandemic, changing sick leave policies could reduce the relative AR by 1-42%; the relative reductions were found to decrease with higher R_0. Similar findings were obtained with seasonal epidemics. The most effective strategy was 90% withdrawal to the home 0.5 days following symptom onset. The least effective strategy was withdrawal after 2 days of symptom onset. With regard to the economic consequences of the various interventions, the most central cost driver was productivity losses. The relative cost per case avoided tended to increase with R_0 or R_eff. While final results on the net benefit of the various interventions are in preparation, preliminary analyses indicate an economic benefit ranging from €180 to €390 per avoided case. The economic benefit to society of the strategy yielding the greatest number of avoided cases was estimated to be €22 million (in Norway). Conclusions Sick leave practices can have a substantial impact on the health and economic consequences of influenza. Improving current recommendations can reduce the health and economic burden of influenza. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P89 POSTE R A BSTRAC TS SPA4: ANTIVIRALS AND RESISTANCE SPA4P01 Evaluation of heterosubtypic cross-protection by active infection and TIV-vaccination of human seasonal influenza virus in ferret models Choi, Young-Ki Chungbuk National University, Korea, Republic of (South Korea) Background Since 1997, highly pathogenic avian influenza (HPAI) H5N1 viruses circulated among domestic poultry and wild birds in Asia, Africa and Europe and believed to have undergone genetic evolution. Moreover, World Health Organization (WHO) reported a mortality rate of 59% out of the 630 human cases of HPAI H5N1 infections worldwide from 2003 to June 2013. There is, therefore, a growing concern that HPAI H5N1 viruses might cause the next pandemic. Here, we investigated the long term heterosubtypic cross-protection by natural infection, or immunization with trivalent human seasonal inactivated vaccine (TIV) followed by fatal HPAI A/Vietnam /1203/04 (H5N1) virus challenge in ferret models. Methods Groups (n=6) of ferrets were inoculated intranasally with human seasonal A/H1N1 (A/California/07/2009, group A) or A/H3N2 (A/Perth/16/2009, group B) virus for imitating natural infection, and additional ferrets were immunized with seasonal TIV (group C) three times with two-week interval. Three months after infection or last immunization, antibody responses were measured by hemagglutination inhibition (HI) and virus neutralization (VN) assays. After serological assays, group A, B, C and non-treated ferrets (group D) were challenged with lethal dose of HPAI A/ Vietnam/1203/04(H5N1) virus, and evaluated the viral shedding from nasal washes, tissue samples and their mortality. Results Serological assays revealed that the sera from groups A, B and C could elicit moderate titers against homologous viruses at 4 weeks after natural infection or TIV immunization; cross reactivity against the HPAI H5N1 virus was not detected. However, these serologic titers appeared to have receded after 12 weeks post- treatments (infection or immunization). Following viral challenge with HPAI H5N1 virus, the ferrets from group A and B survived but those from group C and D all died. Group A and B exhibited significantly attenuated viral loads in nasal washes, lung, brain and spleen and showed recovery within 9 days post-infection. Notably, group A showed the most reduction of HPAI H5N1 virus replication and attenuated clinical signs. In contrast, the ferrets in groups C and D demonstrated high fever with substantial weight loss accompanied by high replication of the challenge virus at the upper respiratory tract and tissues samples. Therefore immunization with the human seasonal TIV could not protect ferrets from fatal HPAI H5N1 infection. Conclusions Taken together, our findings revealed that natural infection with human seasonal strains are more effective than TIV immunization against fatal HPAI H5N1 infection. Data also suggest that natural virus exposure might provide a long-term protective impact against the A/Vietnam/1203/04(H5N1) challenge virus. Thus, the inactivated human seasonal influenza vaccine might not protect the vaccinated host, while healthy individuals who were previously infected with seasonal influenza A viruses might be more protected from the lethal HPAI H5N1 virus infection. Keywords: influenza vaccine, natural infection, seasonal influenza virus, HPAI H5N1 TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P90 POSTE R A BSTRAC TS SPA4P02 Oseltamivir inhibits influenza virus replication and transmission following ocular-only aerosol inoculation of ferrets Belser, Jessica A; Maines, Taronna R; Creager, Hannah M; Katz, Jacqueline M; Tumpey, Terrence M Centers for Disease Control and Prevention, United States of America Background Neuraminidase inhibitors are frequently employed to limit influenza virus infection and spread following respiratory exposure. However, ocular exposure to influenza virus can also lead to the establishment of a respiratory infection in mammals. Despite a paucity of experimental evidence examining the efficacy of antiviral treatments following non-respiratory exposure routes, oseltamivir prophylaxis has nonetheless been prescribed during outbreaks in humans where conjunctivitis and/or ocular exposure has been reported. There is a need to understand the capacity of currently available antiviral treatments to inhibit virus spread from ocular sites to the respiratory tract. Here, we used a novel method of ocular-only aerosol (OA) inoculation of ferrets to investigate the mechanism of action of the neuraminidase inhibitor oseltamivir in preventing influenza virus infectivity, disease progression, and transmissibility following ocular exposure to the virus. Methods Influenza A viruses of the H5N1, H1N1, H7N3, and H7N9 subtypes were used in this study. OA inoculations were performed by passing aerosolized virus through aerosol-delivery goggles fitted on sedated ferrets, which form a close seal around each eye to prevent respiratory exposure to virus. Ferrets received placebo or 25 mg/kg of body weight/ day oseltamivir given orally twice daily from 2 hrs post-inoculation (p.i.) through day 5 p.i. Ferrets were observed for clinical signs and symptoms, and nasal washes were collected to measure viral replication. Transmission was assessed by placing naïve ferrets in direct contact with inoculated animals. Results All influenza viruses tested were capable of mounting a productive respiratory infection following OA exposure. Oseltamivir administration following OA inoculation with H5N1 virus protected ferrets from a fatal and systemic infection, with all antiviral- treated ferrets surviving the virus exposure. Ferrets inoculated by the OA route with a 2009 H1N1 pandemic virus, a HPAI H7N3 virus, or a LPAI H7N9 virus and treated with oseltamivir shed reduced levels of virus in nasal washes with delayed kinetics compared with ferrets receiving placebo. Transmission of these viruses in a ferret direct contact model was similarly reduced and delayed compared with the efficient transmission of these viruses observed in the absence of antiviral treatment. Comparable results were observed when ferrets received a joint ocular-respiratory exposure of aerosolized virus. Conclusions We demonstrate that oseltamivir treatment effectively limits the establishment of a respiratory infection in ferrets exposed to aerosolized influenza virus by the ocular-only route, and reduces the transmission of viruses of multiple subtypes to naïve contacts when a respiratory infection is ultimately mounted. These findings provide critical experimental evidence in support of the use of neuraminidase inhibitors during outbreaks of influenza virus resulting in ocular disease or ocular exposure. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P91 POSTE R A BSTRAC TS SPA4P03 Oseltamivir resistant and wild type pH1N1 virus infection in ferrets Vidana, Beatriz (1,3); Martorell, Jaime (2); Martínez, Jorge (1,3); Martínez, Pamela (3); G. Migura, Lourdes (3); córdoba, Lorena (3); Casas, Inmaculada (5); Pozo, Francisco (5); Majó, Natàlia (1,3); Montoya, María (3,4) Centre de Recerca en Sanitat Animal (CReSA), Spain; 2: Departament de Medicina i Cirurgia Animals, Universitat Autònoma de Barcelona, Spain; 3: Departament de Sanitat i Anatomia Animals, Universitat Autònoma de Barcelona, Spain; 4: Institut de Recerca i Tecnologia Agroalimentaria (IRTA), Barcelona, Spain; 5: Instituto de Salud Carlos III (ISCIII), Madrid, Spain Background Oseltamivir is a common therapy against IAV infections. It is believed that acquisition of oseltamivir resistance (OsR) would decrease viral virulence. However, OsR pH1N1 viruses have demonstrated a potent ability to spread throughout different populations. The objective of this work was comparing virulence of an OsR and a wild type (Wt) pH1N1 virus, both causing fatal outcome in human patients. Methods Ferrets were divided in two groups; infected with OsR pH1N1 virus A/Baleares/RR6121/2009 (R6), isolated from a young man with leukaemia, and Wt pH1N1 virus A/CastillaLaMancha/RR5911/2009 (F) isolated from a healthy young woman. Clinical signs were daily recorded. Serum acute phase proteins were measured by ELISA at 1, 3, 6 and 10 dpi. Lung histopathology, viral quantification in the lungs and lung immunogenetic responses were measured by immunohistochemistry (IHC) and RT-qPCR at 1, 3 and 10 dpi. Viral loads in nasal swabs were also determined in PFUs at 1, 3 and 10 dpi and serum antibody response against both viral strains was performed by hemagglutination inhibition assay (HI). Results Ferrets infected with F virus showed higher percentage of weight loss comparing with R6 infected animals still 4 dpi. R6 infected animals also showed higher clinical score still 7 dpi. However no differences were observed in temperature variation between viral groups. F infected animals showed more severe histopathologic lesions at 1 and 3 dpi. Viral quantification by RT-qPCR was higher in the lungs of F virus infected animals at 1 but not at 3 dpi. Viral load in nasal swabs was also higher in F infected animals at 3 dpi. R6 infected animals showed higher expression of IFNβ, TLR3, IL-6, CXCL10 and RIG-I at 1 dpi. However, F infected animals showed higher expression of proinflamamtory cytokines such as CXCL10, IL-6, TNFα, IFNγ, and IL-8 at 3 dpi. Both infected animals showed antibody cross- reactivity against both viral strains, further confirming similarities in the Hemagglutinin protein. Conclusions Ferrets infected with Wt pH1N1 virus (F) exhibited a stronger virulence than the OsR virus (R6). However, OsR R6 virus showed similar viral RNA expression in lungs at 3 dpi and a similar increment in temperature. In summary, even when Wt pH1N1 virus exhibited increased fitness and pathogenicity, OsR R6 virus was also able to produce illness with viral shedding and an inflammatory response. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P92 POSTE R A BSTRAC TS SPA4P04 Is it possible to fight influenza by targeting intracellular redox state? Palamara, Anna Teresa (1,2); Sgarbanti, Rossella (3); Amatore, Donatella (1,4); Celestino, Ignacio (1,4); Fraternale, Alessandra (5); Magnani, Mauro (5); Garaci, Enrico (3); Nencioni, Lucia (1) 1: Dept. of Public Health and Infectious Diseases, Institute Pasteur, Cenci-Bolognetti Foundation, ‘‘Sapienza’’ University of Rome, Rome, Italy; 2: IRCCS San Raffaele Pisana Rome, Italy; 3: Telematic University San Raffaele Rome, Italy; 4: CEINGE Advanced Biotechnology, Naples, Italy; 5: Dept. of Biomolecular Sciences, University of Urbino “Carlo Bo”, Urbino, Italy Background We have recently shown that influenza A virus replication is inhibited by treatment of infected cells or mice with a derivative of GSH, GSH-C4. In particular, GSH-C4 is able to impair hemagglutinin (HA) maturation in the endoplasmic reticulum and, as a consequence, to block the progression of virus replicative cycle. Interestingly, pro-GSH molecules, including GSH-C4, are able to increase the intra-macrophage thiol content in vitro and in vivo as well as to shift the immune response towards Th1 which plays a pivotal role in antiviral immunity. On the basis of this background, our study was aimed at evaluating the effect of different redox modulating compounds other than GSH-derivative, on influenza virus replication in lung epithelial cells and/or on virus-induced cytokine production. Materials and Methods For in vitro study, human mucoepidermoid pulmonary carcinoma cells were infected with human and avian influenza A viruses (A/Puerto Rico/8/34 H1N1; A/ULSTER/H7N1) and treated after viral adsorption with redox modulating compounds such as GSH-C4, N-acetyl cysteine (NAC) and Trolox. After different hours of infection, viral proteins, the intracellular redox state (ROS production) and mRNA of cytokines were evaluated through Western blot, FACS analysis and real-time PCR, respectively. Viral titer was measured through hemagglutination and plaque assays. For in vivo studies, Balb/C aged (13 months) mice were infected with mouse-adapted influenza virus PR8 and treated daily with GSH-C4 for 7 days. Bronchoalveolar lavage fluid (BALF) was used for cytokine measure by means of Bioplex multiplex system. Results Among different redox modulating compounds tested, differently from GSH-C4, N-acetyl cysteine (a GSH precursor) and Trolox (a derivative of Vitamin E with ROS scavenging activity) exhibited short-term anti-influenza activity in infected lung epithelial cells, without interfering with viral protein expression or HA folding. In addition, while GSH-C4 was able to decrease the production of TNF-α induced by influenza virus, NAC and Trolox exacerbated the release of this cytokine, suggesting that different redox-regulated pathways (GSH-mediated or ROS-mediated) may be specifically involved in the regulation of virus life cycle and/or inflammatory responses. Moreover, in in vivo studies GSH-C4 administration was able to induce a shift towards a Th1 response in infected aged mice. Conclusions Overall these results indicate that GSH-C4 is effective in both inhibiting influenza virus replication and blocking the cytokine production responsible for the lethality of some viral strains. Moreover, the fact that GSH-C4 modulates the immune response may be considered as an antiviral protective compound in aged people. Our data also demonstrate that not all the so-called “antioxidant drugs” are able to control viral infection. Thus, the efficacy of a specific compound depends on its real ability to affect redox-regulated pathways in different cellular contexts. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P93 POSTE R A BSTRAC TS SPA4P05 Neuraminidase Inhibitors and the Cochrane Reviews – a critical appraisal Lehnert, Regine Magdalene; Matz, Sibylle Renate Federal Institute for Drugs and Medical Devices, Germany Background Shortly after the marketing authorisation of the two neuraminidase inhibitors (NI) zanamivir and oseltamivir, the Cochrane Collaboration published their first meta‐analysis on NI use in prevention and therapy of influenza infection in otherwise healthy adults. Subsequently this meta‐analysis underwent several revisions with the latest review published in April 2014. Each revision of the review generated enormous media and public interest. This is to describe the evolution of the Cochrane reviews from a methodological perspective and also in terms of contents. The results are compared with the past and current licensing status of the neuraminidase inhibitors in Europe and the USA. Materials and Methods All Cochrane Reviews on NI use in otherwise healthy adults were screened; those containing major revisions were analyzed further. Altogether, five reviews were selected, the initial meta‐analysis from 1999 and the revisions dated 2006 (Issue III), 2010, 2012 and 2014. The evolution of the main methodological features as well as the most relevant results of the reviews are described and compared with the product information for the NIs, as approved by the European Medicines Agency (EMA) and US Food and Drug Administration (FDA). Results Over time the results and conclusions of the reviews have changed, particularly with regard to the potential effects of neuraminidase inhibitors on the reduction of influenza related complications. After the 2006 review no new evidence has become available that could have led to the differing results. Instead, this evolution appears to be primarily based on the authors’ decision to include or exclude certain data sources and to run increasing numbers of different analyses on a variety of endpoints. At no time has there been a contradiction between the conclusions of the Cochrane authors and the assessment and licensing status of the neuraminidase inhibitors in Europe or the USA. Conclusions From the perspective of drug regulation these results are reassuring. However, the reasons for the great media interest in each revision of this Cochrane review are not fully understood and could benefit from further exploration. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P94 POSTE R A BSTRAC TS SPA4P06 Antiviral drugs for influenza -A comprehensive review of the evidence with emphasis on relevant clinical endpoints Lehnert, Regine Magdalene (1); Pletz, Mathias W (2); Schaberg, Tom (3); Reuss, Annicka (4); Haas, Walter (4) 1: Federal Institute for Drugs and Medical Devices, Germany; 2: Universitätsklinikum Jena; 3: Agaplesion Diakoniekrankenhaus, Rotenburg/ Wümme; 4: Robert Koch-Institut, Berlin Background In the past years and especially subsequent to the last pandemic in 2009/2010, ample clinical studies and meta‐ analyses on antivirals for influenza have become available. The objective of this review is to provide an overview on the evidence on efficacy and safety of antiviral agents indicated for prevention and treatment of influenza in Germany. Methods A comprehensive literature search of Cochrane Library, PubMed and Scopus was undertaken. We included all available literature published before May 01 2014. As a starting point, we defined clinically relevant questions on the use of antivirals. Data were regarded as appropriate evidence if derived from randomized controlled trials (RCTs) or meta‐analyses thereof. Data were extracted primarily from meta‐analyses. If no meta‐analysis for certain research questions was available, data from RCTs or observational studies were used. Data from observational studies were considered as supportive, particularly in those areas where evidence from RCTs was missing. Titles, abstracts, and full articles were screened by two experts. In case of disagreement a third reviewer was included as arbitrator. AMSTAR criteria for the measurement of the methodological quality were applied where appropriate. Data from these selected publications were extracted, summarized and assessed. In addition, information from regulatory bodies, e.g. from public assessment reports/reviews was included for the safety evaluation. Results Ten meta‐analysis of high to very high quality according to AMSTAR were included. Overall, antivirals lead to a shortening of symptoms of influenza of 0.5 to 1.0 days. For specific agents/in selected populations this effect was more pronounced (e.g. for oseltamivir in children) or has not been proven (e.g. for elderly patients). Prophylactic use reduced the frequency of symptomatic influenza by 60% to 80%. Effects on hospitalisations, serious complications, mortality or other markers of disease severity have not been unequivocally demonstrated in RTCs. However, there are observational studies that have shown statistically significant beneficial effects on severe disease and mortality. Reduction in transmission by use of antivirals has not been proven. The side effects of neuraminidase inhibitors are generally less pronounced than those of amantadine. Specifically, side effects predominantly occur in the neuropsychiatric system (amantadine and possibly oseltamivir), respiratory system (zanamivir), gastrointestinal system and skin (oseltamivir). Conclusions Despite the lack of evidence to answer some of the clinically relevant questions, the demonstrated effects and the findings from observational studies do allow the conclusion of an overall positive benefit/risk ratio for the use of antivirals against seasonal and pandemic influenza. In a pandemic situation these effects may become relevant for the individual as well as for society, when antivirals may be used for prophylaxis and for therapy, particularly in consideration of the lack of other options. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P95 POSTE R A BSTRAC TS SPA4P07 Heterologous Polyclonal Antibodies, Past and Present, with Future Applications to Avian Influenza and Other Neglected Viruses. Dixit, Rashmi (1); Herbreteau, Cécile Hélène (2); Herz, Jenny (3); Booy, Robert (1); Lepine, Bertrand (2) 1: The Children’s Hospital, Westmead, Australia; 2: Fab’entech; 3: Bio-intellect Background Increasing neuraminidase inhibitor resistance, the emergence of pathogenic avian strains with pandemic potential, and the lack of vaccines against novel strains each challenge influenza management. Polyclonal antibody therapy has been applied to prophylaxis of rabies, and treatment of intoxications and envenomations. However, human derived polyclonal antibodies production is limited. This review examines the historic of polyclonals use in human, their future applications, and their potential application in both prophylaxis and treatment of influenza. Methods A literature review, published and grey, of the Medline database search was conducted, seeking original studies and reviews on animal-derived polyclonal antibodies, their effectiveness and their safety, and current research into potential applications. Results Serum therapy was first used in the 1890s against diphtheria. Its use expanded in the pre- antibiotic area to treat a range of bacteria and viruses, including the 1918 Spanish Influenza pandemic. Crude preparation and purification techniques yielded products contaminated with large amounts of animal proteins, associated with high rates of serum sickness. With the development of antibiotics and high vaccine uptake, serum use contracted. However, enzymatic digestion, and increased purification techniques such as ammonium sulphate precipitation, thermocaogulation and chromatographic purification hugely raised their safety profile and allow the use of highly purified F(ab’)2 fragments for the management of intoxication or disease such as rabies, until today. The use of neutralising F(ab’)2 fragments, removed of the Fc fragment of the antibody (harbouring species specificity and responsible of mainly of the adverse events) , allow a drastic reduction in hypersensitivity reaction. Modern animal derived polyclonal antibody products are increasingly purified, very safe and effective. For seasonal and avian influenza, heterologous polyclonal antibodies have been demonstrated to be effective in mouse models, and a recent phase I clinical trial on Fabenflu® (anti-H5N1 F(ab’)2) gave reassuring safety data in human. Merely substituting one vaccine in horses for a previous can enable rapid development of immunotherapy to emergent influenza strains. In the near future, application of polyclonal serum therapy may be applied to a range of neglected viral diseases such as various viral haemorrhagic fevers and bat-transmitted viruses. Conclusions Heterologous polyclonal antibody therapy is economical, safe, effective with large cross- reactivity activity and can be rapidly produced, with application to many pathogens for which there are no efficient prophylactic and therapeutic options. This mode of therapy may provide a viable strategy against pandemics of emergent influenza strains. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P96 POSTE R A BSTRAC TS SPA4P08 Comparative analysis and anti-viral activity of medicinal plant extracts against Influenza A virus: An in-vitro study. Roy, Saugata; Saxena, Latika; Kumar, Binod; Khanna, Madhu Vallabhbhai Patel Chest Institute, India Background Influenza virus is a respiratory pathogen of global importance which causes a high degree of morbidity and mortality. Due to frequent antigenic and genetic changes, vaccines need to be formulated yearly thus requiring lot of financial investment. Naturally derived products from medicinal plants have shown great potential in preventing and or ameliorating diseases. This study aims at evaluating the antiviral efficacy of Trachyspermum ammi, Curcuma longa and Solanum nigrum medicinal plant extracts, having expected antiviral activity for the development of an alternative and effective therapy against Influenza A viruses. Methods Certified Plant materials were procured and extracts were prepared in ethanol. The extracts were dissolved in DMSO, aliquoted and stored in -20°C. Cytotoxicity was checked by MTT assay after 24h and 48h in A549 cells. The Antiviral activity of the extract was assessed against Influenza A virus (A/PR/8/34-H1N1) infection by real time PCR. Plaque reduction assay was performed in MDCK cells from cell supernatant of infected A549 cells treated with plant extracts. Results A marked reduction in cytopathic effect caused by Influenza A Virus was observed post treatment Trachyspermum ammi in A549 cells. A similar inhibition in viral RNA (56% approx) was observed by real time PCR when treated with Trachyspermum ammi extracts whereas other plant extracts (Curcuma longa and Solanum nigrum) showed lesser inhibition. Relative reduction of plaques was observed in Trachyspermum ammi treated cell supernatant of A549 cells. Conclusions Extract from Trachyspermum ammi showed potential inhibition of replication Influenza A virus in A549 cells. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P97 POSTE R A BSTRAC TS SPA4P09 Viral shedding and susceptibility to oseltamivir in hospitalised immunocompromised patients with influenza in the Influenza Resistance Information Study (IRIS) Fraaij, Pieter (1); Schutten, Martin (1); Javouhey, Etienne (2); Burleigh, Laura (3); Outlaw, Russell (4); Kumar, Deepali (5); Boucher, Charles (1) 1: Erasmus MC, Rotterdam, The Netherlands; 2: Hôpital Femme Mère Enfant, Lyon, France; 3: Roche Products Ltd, Welwyn, UK; 4: Micron Research Ltd, Ely, UK; 5: Toronto General Hospital, Toronto, Canada Background Oseltamivir is widely used to treat influenza, especially in patients at risk of severe infection such as immunocompromised individuals. Recent publications have raised concerns that influenza viruses may develop resistance to oseltamivir in immunocompromised patients. As few prospective data are currently available on this subject, the IRIS (NCT00884117) sub-study was initiated to assist the detection of resistance to antivirals in a population of immunocompromised patients infected with influenza and describe their clinical outcomes. Methods This sub-study is a prospective, multicenter, information-gathering study. Between February 2012 and March 2013, immunocompromised patients aged ≥1 year with a rapid diagnostic or PCR test positive for influenza up to 96 hours after diagnosis, and displaying symptoms suggestive of influenza-like illness, were eligible for inclusion. The level of immunosuppression was retrospectively scored on the likelihood of decreased viral clearance, ranging from 1 (very unlikely) to 4 (highly likely). Clearance of virus was assessed by RT-PCR assay of viral RNA in nasal and throat swabs taken on Day 1, then every 3 days until patients were virus-free. Patients were treated in accordance with local routine clinical practice. Results A total of 42 patients were included in the study: 29 adults (age range, 22–83 years) and 13 children (aged 1–12 years). The level of immunosuppression was mostly mild, with >80% of patients being scored as level 1 or 2. Twenty-nine (69%) patients (mean age, 36 years) were influenza-positive by RT-PCR on Day 1, with H1N1pdm09 being the most common infecting virus subtype (15/29 patients). No resistant viruses were detected at baseline. On Days 3 and 6, the majority of patients tested remained influenza-positive (18/24 and 9/15, respectively). The H275Y mutation was found in post-Day 1 samples from four adult patients (age range, 52–61 years); three patients cleared the virus, but one severely immunocompromised patient was virus-positive until Day 15 when he died. Post-Day 9 samples were available for five patients, of whom two continued to shed virus, including the aforementioned patient. Follow-up beyond Day 9 was limited because symptoms resolved in most patients and they could then be discharged from hospital, with no further follow-up required. Indeed, most patients only had mild symptoms; however, 10 patients (seven influenza-positive) were admitted to the intensive care unit and three (two influenza-positive) died. Conclusions In this group of mostly mildly immunocompromised patients, emergence of oseltamivir-resistant viruses during treatment was detected in four patients, but there was no clear association between resistance and prolonged viral shedding. The clinical course of disease was benign in most patients; however, more serious disease was encountered, including one fatal case in a patient with resistant virus and prolonged shedding. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P98 POSTE R A BSTRAC TS SPA4P10 Novel inhibitors targeting influenza virus and pneumococcal neuraminidase (NA) Walther, Elisabeth (1); Richter, Martina (1); Xu, Zhongli (1); Bohn, Kathrin (1); Rollinger, Judith (2); von Grafenstein, Susannne (3); Liedl, Klaus (3); Kirchmair, Johannes (4); Sauerbrei, Andreas (1); Pfister, Wolfgang (5); Schmidtke, Michaela (1) 1: Jena University Hospital, Department of Virology and Antiviral Therapy, Jena, Germany; 2: University of Innsbruck, Institute of Pharmacognosy and Center for Molecular Biosciences, Innsbruck, Austria; 3: University of Innsbruck, Institute of Theoretical Chemistry and Center for Molecular Biosciences, Innsbruck, Austria; 4: Swiss Federal Institute of Technology Zurich, Zurich, Switzerland; 5: Jena University Hospital, Department of Medical Microbiology, Jena, Germany Background Secondary bacterial infections, in particular with Streptococcus pneumoniae, represent a major cause of excess morbidity and mortality during influenza. Because of structural and functional similarities, pneumococcal NA (NanA) can promote the release and spread of virus in a similar fashion than viral NA. Hence, bacterial NA needs to be considered as valid therapeutic target for the treatment of flu infections. We identified a series of compounds identified by virtual screening applying an ensemble-based molecular docking. The series shares a common chemical scaffold with at least one acidic function and an aromatic core with diazenyl linker (here in referred to as azo acid compounds). In the present study, we investigate these novel promising compounds with significant inhibitory efficacy on influenza virus as well as pneumococci. Methods The susceptibility of a pneumococcal strain serotype 2 and a pandemic influenza A virus (A(H1N1)pdm09) and/ or their NA was studied against 37 azo acid compounds in human erythrocyte-based NA inhibition assays in comparison to oseltamivir and zanamivir. Pneumococcal NA was obtained either as a component of bacterial total surface protein via precipitation, or individually synthesized via in vitro expression system. By incubating virus with in vitro-expressed NanA in A549 cells the dual-effect of NA inhibition was investigated in an in vitro co-infection model. Here, the plaque reduction assay was used to analyze the compounds’ effect on virus yield and immunohistochemical staining of viral nucleoprotein to evaluate the effect on virus spread. Results The susceptibility of NanA to oseltamivir as well as its resistance to zanamivir (Gut et al., J. Mol. Biol., 2011) was confirmed. In comparison to viral NA, NanA was about 103-fold less sensitive to oseltamivir (IC50 of 0.002 μM and 2 μM, respectively). Eight and ten out of 37 tested compounds showed a mean inhibitory concentration equal or lower than 10 μM against viral and bacterial NA, respectively. Four compounds active on both NAs were selected for studying their inhibitory effect in an in vitro co-infection model. Here, NanA significantly increased viral yield and spread. Zanamivir efficiently blocked viral replication in A549 cells. However, no effect was observed when virus-infected A549 cells were co-incubated with in vitro-expressed NanA. In contrast, oseltamivir and the novel compounds showed dose-dependent inhibition of the viral replication in the presence and absence of NanA. Conclusions Our results demonstrate that dual-active inhibitors targeting viral and pneumococcal NA prevent viral replication in the presence and absence of pneumococcal NA. Therefore, this novel antimicrobial inhibition profile has the potential to be optimized for the development of lead structures combating co-infected influenza. This work is supported by the Austrian Science Fund (FWF: P24587 & P23051) and the Thuringian Ministry of Economy, Labour and Technology funded by the European Social Fund (2011FGR0137). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P99 POSTE R A BSTRAC TS SPA4P11 Five years of monitoring for the emergence of oseltamivir resistance in patients with influenza A virus infections in the Influenza Resistance Information Study (IRIS) Lina, Bruno (1); Boucher, Charles (2); Osterhaus, Albert (2); Schutten, Martin (2); Monto, Arnold (3); Whitley, Richard J (4); Nguyen-Van-Tam, Jonathan (5) 1: University Claude Bernard Lyon1, Lyon, France; 2: Erasmus MC, Rotterdam, The Netherlands; 3: University of Michigan School of Public Health, Ann Arbor, MI, USA; 4: University of Alabama at Birmingham, Birmingham, AL, USA; 5: University of Nottingham, Nottingham, UK Aim Following naturally-occurring oseltamivir resistance in 2008, a global observational trial, the Influenza Resistance Information Study (IRIS; NCT00884117) was initiated to study the emergence of neuraminidase inhibitor (NAI) resistance and the clinical course of influenza in non-immunocompromised treated and untreated patients. Methods Patients with influenza-like illness and/or a positive rapid test result for influenza had throat/nose swabs collected on Days 1, 3, 6 and 10 for real-time RT-PCR analyses of influenza type, subtype and NAI resistance. Positive samples were cultured, sequenced (HA, NA and M2) and phenotypically tested for NAI resistance. Scores for influenza symptoms (0 [absent], 1 [mild], 2 [moderate], 3 [severe]) were recorded on diary cards by the patient (Days 1–12). Results Of 3230 RT-PCR-positive patients with a single influenza strain infection in years 1 to 5, 2316 had influenza A of whom 1216 received oseltamivir monotherapy within 2 days of symptom onset (9 seasonal H1N1; 662 H3N2; 545 have been detected. the followup, 11with of the 43naturally patients resistant (25.6%) were still RTPCR H1N1pdm2009). ExceptInfor the 9 patients the seasonal H1N1 positive in 2008, no resistance has been detected in the Day1 samples during the 5-year study. However, emergence of resistance (post-Day 1) was at Day 10, but their symptoms resolved by Day 6. In 60% of the sample in which resistance first detected by mutation-specific RT-PCR in 43 oseltamivir-treated influenza A patients (see Table), mostly with a mixed genotype. a limited trend of resistant viruses over the years (see Table). This was not correlated appearedThere viral was loads were too lowof forincrease phenotyping. to any sustained substitution in the NA or HA of the viruses. All resistant viruses had either the H275Y substitution : In years 1–5 of IRIS, emergent resistance to oseltamivir in influenza A viruses was for N1 viruses (27), or the R292K substitution for N2 viruses (16). No other substitutions associated to resistance 1detected have beenonly detected. the follow-up, 11 of the 43 patients (25.6%) were still RT-PCR positive during In the course of antiviral treatment, mostly in 1–5yearold and with mixedat Day 10, but their symptoms resolved by Day 6. In 60% of the sample in which resistance first appeared viral loads were too low for virus population. This post treatment emergence of resistance appears to be more frequent phenotyping. in the last 3 years. In the clinical management, this resistance had modest effect on viral Conclusions clearance no effect on symptom resolution. In years 1–5and of IRIS, emergent resistance to oseltamivir in influenza A viruses was detected only during the course of antiviral treatment, mostly in 1–5-year-old and with mixed virus population. This post treatment emergence of resistance appears to be more frequent in the last 3 years. In the clinical management, this resistance had modest effect viral clearance and no(mutationspecific effect on symptomRTPCR) resolution. onEmergent resistance by age group and year in treated patients with at least one postDay1 sample Table. Emergent resistance (mutation-specific RT-PCR) by age group and year in treated patients with at least one post-Day-1 sample Resistance mutation Age group H275Y in H1N1 (2009) 2008-10 1–5 years 2010-11 1/48 (2,1%) 12/53 (22,6%) Virus Resistance negativ e by rate (treated R292K in H3N2 RTPCR at influenza A 2011-12 2012-13 2008-10 2010-11 2011-12 2012-13 Day 10 patients) 1/5 (20%) 6/18 (33%) 0/1 (0%) 1/36 (2,8%) 2/16 (12,5%) 7/76 (9,2%) 24/30 30/253 (11,8%) 6–12 years 0/75 (0%) 1/30 ( 3,3%) 0/6 (0%) 1/4 (25%) 0/1 (0%) 0/42 (0%) 2/15 (13,3%) 1/76 (1,3%) 2/5 5/249 (2%) ≥13 years 1/95 (1,1%) 2/143 (1,4%) 0/15 (0%) 2/35 (5,7%) 0/20 (0%) 1/112 (0%) 0/66 (0%) 2/174 (1,2%) 6/8 8/660 (1.2%) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P100 POSTE R A BSTRAC TS SPA4P12 Hemagglutination (HA)-based neuraminidase (NA) inhibitory assays to search for novel NA inhibitors (NAIs) Richter, Martina (1); Walther, Elisabeth (1); Bohn, Kathrin (1); Xu, Zhongli (1); Grienke, Ulrike (2); Rollinger, Judith M. (2); von Grafenstein, Susanne (3); Liedl, Klaus R. (3); Kirchmair, Johannes (4); Sauerbrei, Andreas (1); Schmidtke, Michaela (1) 1: Jena University Hospital, Department of Virology and Antiviral Therapy, Jena, Germany; 2: Institute of Pharmacy/Pharmacognosy, Center for Molecular Biosciences Innsbruck, University of Innsbruck, Innsbruck, Austria; 3: Institute of General, Inorganic and Theoretical Chemistry, Center for Molecular Biosciences Innsbruck, University of Innsbruck, Innsbruck, Austria; 4: Department of Chemistry and Applied Biosciences, Institute of Pharmaceutical Sciences, ETH Zurich, Zurich, Switzerland Background Emergence and circulation of NAI-resistant influenza viruses underline the need to search for novel resistancebreaking NAIs. Flu-associated secondary bacterial pneumonia, most commonly caused by Streptococcus pneumoniae, renders bacterial NA an additional druggable target. Chemiluminescence (CL)- and fluorescence (FL)based NA inhibitory assays can be applied to screen for NAIs. The reliability of results from both assays is under discussion (Kongkamnerd et al., J Biomol Screen. 2011; Grienke et al., J Nat Prod. 2014). Due to quenching effects and self- fluorescence, these assays can lead to false-positive or -negative results. The aim of this study was to establish NA inhibition assays overcoming these drawbacks. Methods Inhibition of influenza A virus NA and bacterial NA (from S. pneumoniae, C. perfringens, V. cholerae) by well-known (oseltamivir, zanamivir, DANA) and novel NAIs (isolated from medicinal plants or selected by structure similaritybased screening) was compared in (i) commercially available CL- and FL-based NA inhibitory assays and in (ii) HAbased NA inhibitory assays with human erythrocytes. Results When testing the approved NAIs, the CL-based NA inhibition assay reported higher sensitivity than its FL-based counterpart. The results from both assays correlated well for viral as well as pneumococcal NA. In contrast to that, the results markedly differed in these assays for some natural compounds, e.g. katsumadain A, because of strong quenching effects or an increase in the FL signal (due to self-fluorescence). For several compounds showing activity in the CL assay with viral NA, no or only poor inhibition was detected in the FL assay. However, these compounds showed activity in both assay formats for pneumococcal NA. This corroborated our concerns regarding the reliability of these assays and prompted us to search for alternative assays that overcome the interference of the test compound with light signals as well as substrate differences that might be the reason for the observed artifacts. As a result, viral and bacterial NA inhibitory assays based on human erythrocyte binding and elution were established that work under physiological conditions. We found that these HA-based assays work most reliably with novel NAIs acting against viral and/or bacterial NA. Conclusions The HA-based NA inhibitory assays enable the screening for novel NAIs under physiological conditions. FL- and/or CL-based NA inhibition assays can be used to confirm the activity after exclusion of quenching and self-fluorescence. This work is supported by the Austrian Science Fund (FWF: P24587 & P23051) and the Thuringian Ministry of Economy, Labour and Technology funded by the European Social Fund (2011FGR0137). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P101 POSTE R A BSTRAC TS SPA4P13 Identification of amino acids important for binding of novel oseltamivir and zanamivir derivatives by using recombinant influenza viruses Hoffmann, Anja (1); Schade, Dennis (2); Kirchmair, Johannes (3); Sauerbrei, Andreas (1); Schmidtke, Michaela (1) 1: Jena University Hospital, Department of Virology and Antiviral Therapy, Jena, Germany; 2: Department of Chemistry and Chemical Biology, TU Dortmund University, Dortmund, Germany; 3: Swiss Federal Institute of Technology Zurich, Zurich, Switzerland Background Neuraminidase inhibitors (NAI; e.g. oseltamivir and zanamivir) are the only medicines approved for the prevention and treatment of influenza. Emerging resistances urge for the development of novel resistance-breaking drugs like the orally bioavailable amidine derivative of oseltamivir which was shown to be active against an oseltamivirresistant influenza A virus (Schade et al., J Med Chem. 2014). The aim of the present study is the identification of amino acids (aa) that may influence the binding and thereby the activity of novel oseltamivir and zanamivir analogs, which have been synthesized to overcome resistance mechanisms. Methods Several aa substitutions of neuraminidase (NA), known or presumed to cause drug resistance, were generated by sitedirected mutagenesis. Recombinant viruses were rescued with the help of an eight- plasmid transfection system. The susceptibility of the variants and wild type WSN/1933 against amidine and guanidine analogs of oseltamivir as well as a zanamivir analog was compared by fluorescence- and chemiluminescence-based NA inhibition assays. Possible binding poses of the NAI into the NA active site have been modeled based on experimental data. Results By using a shared genetic background it was possible to attribute observed differences exclusively to the provided mutations. The aa substitutions influenced the drug efficacy and resulted in different levels of resistance. In chemiluminescence-based NA-activity assays (CL-assays) a strong increase in oseltamivir 50% inhibitory concentration (IC50) was observed (250-fold for variant NA H275Y and 60- fold for variant NA N294S). Both, the guanidine and the amidine analog of oseltamivir reduced this resistance considerably. In context of wild type A/ WSN/1933 virus these oseltamivir derivatives showed a higher inhibitory activity than their parent compound in contrast to the zanamivir derivative that presented increased IC50-values. The substitution of tyrosine to histidine at position 155 had little influence on the inhibitory effect of oseltamivir and its derivatives, whereas for zanamivir a change in IC50 of up to 10-fold was observed when compared to the wild type. The zanamivir analog was unable to break this resistance as determined by CL-assay. Variant NA Q136L had no influence on the inhibitory activity of any of the investigated compounds. Results for oseltamivir derivatives were confirmed by fluorescence-based assay (FL-assay). As shown previously (Nguyen et al., AAC 2010), the change in resistance measured with the FL-assay was more pronounced than with the CL-assay. In case of the Y155H variant FL- and CL-assay data did not correlate well. Conclusions Using genetically modified influenza viruses, the underlying molecular mechanisms of action of novel oseltamivir and zanamivir derivatives was shown. In particular the NA aa H275, Y155, and N294 are crucial for this mechanism in A/WSN/1933. With this knowledge further strategies for developing resistance-breaking agents can be derived. This work is supported by the European Social Fund (2011-FGR0137). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P102 POSTE R A BSTRAC TS SPA4P14 Antiviral effect of new oseltamivir derivates against influenza A virus García-Machorro, Jazmín (1); Neri-Bazan, Rocio M. (1); Correa-Basurto, José (1); Trujillo-Ferrara, José G. (1); Tolentino-López, Luis (1); MartínezRamos, Federico (2); Velazquez-Quiroz, Isaac (3); Jímenez-Estrada, Juan M. (3); Soriano-Ursúa, Marvin A. (1); Aguilar-Faisal, José L. (1) 1: Escuela Superior de Medicina. Instituto Politécnico Nacional, Mexico; 2: Escuela Nacional de Ciencias Biológicas. Instituto Politécnico Nacional, México; 3: Instituto de Salud del Estado de México Background Recently, the emergence of drug resistant influenza A virus, such as H274Y mutation in neuraminidase that confers high resistance to neuraminidase inhibitors, led to the design of new compounds derivates of oseltamivir which increase the afinity on the mutant variants and on many subtypes of influenza. These new arylic-oseltamivir derivates have as target a cluster of arginines residues highly conserved (Arg118, Arg292, and Arg371) between different subtypes of the neuraminadase active site. According to bioinformatic tools, there are serveral interactions including pi-cation and pi-pi interactions between the arylic compounds and aromatic or positively charged residues present in the pocket site which improve properties as stability and recognition of oseltamivir. To confirm this, we evaluate the antiviral activity in vitro of these compounds on a influenza virus strain AH1N1. Methods Based on virtual screening (molecular dynamics and docking studies) were selected six compounds with the best scoring on Kd and ΔG, the best physicochemical (Lipinski rule) and toxicological properties, then these compounds were synthesized. Then, we decided evaluate if the new compounds have any inhibitory activity in vitro against influenza A virus H1N1 by Enzychrom neuraminidase assay kit. After, we determined the cytotoxicity of each compound at different concentrations (250 nM to 5000 nM) on Vero, HeLa and MDCK cells by trypan blue at 24 and 48h. Furthermore antiviral activity was determinated at 250 nM (minimal cytotoxic concentration assayed) by supernatant titration from MDCK cells infected with AH1N1 virus at 5 MOI. Finally, we analyzed the roughness on infected, non infected and compound treated MDCK cell surface by Atomic Force Microscopy. Results In neuraminidase inhibition activity we determinated the IC50 of the arilic compounds and was lower (75 nM) than the oseltamivir carboxyilate (200 nM), moreover only two compounds were cytotoxic at 250 nM concentration. We found that the compound whit the group p-hidroxylaniline had the best antiviral activity (47% plaque reduction), compared with the activity of oseltamivir caroxylate (35% plaque reduction) (ANOVA one way, α 0.05). Conclusions We found that as a virtual screening has predicted, the new oseltamivir derivates have antiviral activity better than the oseltamivir carboxylate, in the case of the p-hidroxylaniline substitution compound. The compounds showed no citotoxicity at high concentrations and the best compound has inhibitory effect better than the oseltamivir at lower concentrations. On the other hand is necessary to verify the activity of the compounds in other influenza strains including H274Y mutant. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P103 POSTE R A BSTRAC TS SPA4P15 Indirect effects of oseltamivir treatment of an influenza-infected index case-patient on secondary household transmission: A randomized placebo-controlled clinical trial in a crowded urban area in Bangladesh Alicia M Fry (1), Doli Goswami (2), Kamrun Nahar (2), Amina Tahia Sharmin (2), Mustafizur Rahmun (2), Larisa Gubareva (1), Tasnim Azim (2), Joseph Bresee (1), Stephen P Luby (2) (3), W Abdullah Brooks (2) 1: Influenza Division, 3: Centers for Disease Control and Prevention, Atlanta, GA USA; 2: International Centre for Diarrhoeal Disease Research, Bangladesh, Dhaka, Bangladesh Background Prophylactic use of oseltamivir can prevent influenza infection and illness when given prior to exposure or immediately after exposure to an infectious person. However, during a pandemic, a large drug supply would be needed if prophylactic use was recommended. Oseltamivir treatment reduces virus shedding and may reduce infectiousness and subsequent virus transmission to susceptible individuals. However, studies supporting a reduction in transmission are limited. Prior to the 2009 pandemic, we initiated a double blind, randomized, placebocontrolled trial in a crowded area in Dhaka, Bangladesh to determine the indirect effects of treatment of an index case-patient on secondary household transmission. Methods From May 11, 2008 through December 31, 2010, we enrolled ill index patients with a positive rapid influenza test and randomized 1:1 placebo to oseltamivir. The index patient and household members were monitored daily for illness. Household members with one major symptom (e.g., fever, tachypnea, breathing difficulty) or two minor symptoms (e.g., cough, sore throat, chills, myalgia, rhinorrhea,) were sent to the clinic for a nasal wash specimen. All specimens were tested for influenza with reverse transcriptase-polymerase chain reaction (PCR). We compared secondary attack rate (SAR) due to illness and PCR-confirmed influenza between households with an index patient randomized to oseltamivir treatment versus placebo. Efficacy =1-SARo/SARp estimated from a log binomial model adjusting for household clustering. Index patients and their households were pre-specified to be stratified by onset of the index case-patient’s major symptoms relative to enrollment, <48 hours or 48-120 hours (“>48 hours”). All analyses were intent to treat, except where noted. Results Among 6,544 households under surveillance, 1190 index case-patients and their households were enrolled into the study; 794 (67%) index case-patients were enrolled <48 hours (median 1 day) and 396 (33%) were enrolled >48 hours (median 3 days) since symptom onset. Overall, 2292 and 2402 household members were monitored from placebo and oseltamivir treated index case-patient households. Median age of index case-patients was 5 years, interquartile range (IQR) 2,9) and infecting viruses included influenza A(H3N2) (35%), seasonal influenza A (H1N1) (11%), A(H1N1) pdm09 (18%), and influenza B virus (33%). The median household size, excluding index-patients, was 4 (IQR 3,5) and the median age of household members was 24 years (IQR 10,34). The median interval from index enrollment to household illness was 1 day; 32% of household illness occurred before or on same day as index enrollment and 27% occurred 1 day after enrollment, there were no differences between groups. The SAR for illness was less in the oseltamivir group (196/2402 [8.1%]) compared to the placebo group (233/2292 [10%], p=0.02; efficacy= 0.23, 95% confidence interval [CI]: 0.02, 0.39). The SAR for PCR-confirmed illness was not statistically different between placebo (4.5%) and oseltamivir groups (3.8%, p=0.20); however, only 57% of ill household members had a respiratory specimen collected for PCR. The efficacy was similar after households with an illness before or on the same day as the index case-patient enrollment, or with incomplete household illness onset dates, were excluded (n=208 households): illness efficacy=0.29 (CI: -0.005, 5) and PCR influenza efficacy= 0.24 (CI: -0.75, 67). Among these later households with index case-patients enrolled > 48 hours from illness onset, the efficacy against illness = 0.46 (CI: TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P104 POSTE R A BSTRAC TS 0.06, 0.72) and the efficacy against PCR-confirmed illness = 0.53 (-1.9, 92). Among households with index casepatients enrolled< 48 hours from illness onset, the efficacy against illness = 0.22 (CI:-0.17, 0.49) and the efficacy against PCR-confirmed illness = 0.12 (-1.2, 65). Conclusions In a crowded low income setting, oseltamivir treatment of an index case-patient resulted in a 20% reduction in secondary illness among household members when treatment was started within120 hours after illness onset. In our study, efficacy was higher among households with index case-patients enrolled > 48 hours from illness onset. Future studies will explore these results and their relevance more completely. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P105 POSTE R A BSTRAC TS SPB4: ANIMAL FLU-ECOLOGY AND EPIDEMIOLOGY OF ANIMAL INFLUENZA SPB4P01 Phylogenetic relationships of genes of hemagglutinin and matrix protein of influenza A/equine/Kazakhstan/236/12 (H3N8) virus Khan, Yelizaveta RSE “Institute of microbiology and virology” CS MES RK, Kazakhstan The presently known horse influenza viruses belong to two subtypes: A (H7N7) and A (H3N8). The first strain of influenza A virus (H7N7) was isolated in Czechoslovakia in 1956 (Bryant, 2009; Mumford, 2010). The latest outbreak caused by H7N7 virus was registered in 1979, no more cases of its isolation have been reported. In 1963, during a severe epizootic in Florida related to importation of horses from Argentina, influenza A virus (N3N8) appeared, which by now widely is circulating in many countries (Australia, China, Mongolia, Japan, India, etc. ) (Daly, 1996). This paper presents data on isolation of influenza A (H3N8) virus from sick horses in southern Kazakhstan and study of their biological properties. In 2012, during a local outbreak of acute respiratory infection in South Kazakhstan region from sick horse haemagglutinating agent was isolated identified by reverse transcription-polymerase chain reaction, hemagglutination inhibition and inhibition of neuraminidase activity assays, as influenza A genus subtype H3N8 virus. Its main biological properties: hemagglutinin (HA) thermal sensitivity, resistance to blood serum inhibitors, spectrum of hemagglutinating activity, degree of adsorption and elution from chicken erythrocytes were studied, and the phylogenetic relationships between HA and matrix protein (M) genes of A/equine/Kazakhstan/236/12 (H3N8) influenza virus and viruses of this subtype from GenBank were established. Molecular genetic analysis revealed the highest changes in HA gene where five unique nucleotide substitutions were found specific to cluster of Central Asian viruses. It is shown that according to HA and M genes A/equine/Kazakhstan/236/12 isolate refers to Florida 2 subline cluster of viruses within the American line, which includes viruses isolated in Europe and in the countries bordering with Kazakhstan: China, Mongolia and North India. All viruses in this cluster phylogenetically ascend to the virus A/ equine/Newmarket/5/2003. Isolation of influenza A (H3N8) virus from horses in South Kazakhstan and the epizootological situation in the republic formed over the past 10 years, require constant monitoring of influenza dissemination and studying antigenic and molecular biological properties of newly isolates. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P106 POSTE R A BSTRAC TS SPB4P02 Surveillance of influenza virus subtypes H1, H2, H3 among wild birds in Ukraine in 2006-2012 Muzyka, Denys (1); Pantin-Jackwood, Mary (2); Stegniy, Borys (1) 1: National Scientific Center Institute of Experimental and Clinical Veterinary Medicine, Ukraine; 2: Southeast Poultry Research Laboratory, Agricultural Research Service, USDA, Athens, Georgia, US Background Influenza is one of the most dangerous and unpredictable diseases of humans, other mammals and birds. There is some danger of AIV of H5, H7 subtypes to human health. Influenza virus of H1, H2, H3 subtypes, circulate in humans an cause seasonal influenza. Similar subtypes are also circulating in the natural reservoir, wild aquatic birds. Under certain conditions, they can be donors of genes for new epidemic viruses. In this study, we examined the features of circulating H1, H2, H3 influenza viruses in wild birds of various environmental groups in Ukraine. Methods Monitoring of circulating influenza virus of H1, H2, H3 subtypes was conducted in 2006-2012 in different regions of Ukraine. Serology for the detection of influenza antibodies was conducted with samples collected from 946 wild birds of 44 species and samples from 6281 wild birds of 84 species and 27 families were examined for the presence of virus. All studies were performed as recommended by the OIE. Results 6.06% of Dunlin, 5.88% of Grey Plover, 14.28 % of Curlew Sandpiper, 40% of Broad-billed Sandpiper in 2006, 15.38 % of Mute Swan in 2008 and 6.97% of mallards in 2011 had antibodies to H1 influenza virus in serum. Also, antibodies were found in egg yolks of Song Thrush, Blackbird, Jay in 2006, 3.22 - 4.16 % of mallard yolks in 2009. Antibodies to H2 AIV in serum were found in 2006, 2009, 2011 at 13.04%, 1.61%, 1.55% -3.04 of mallards respectively, while at egg yolks in 2006 at Song Thrush, Great Tit, Slender-billed Gull and egg yolks of mallards (12.5%). Antibodies to H3 AIV were found in 2006 at egg yolks of Yellow-legged Gull (23.07%), in 2007 in yolks of Coot (33.3%) and Grey Plover (14.28%), in 2008 at yolks of Common Tern, in 2009 at blood serum of mallards (12.90%). Ninety eight hemagglutinating viruses were isolated, including 23 isolates of avian paramyxovirus and 69 AIV.. Of these AIV, 8 were H1 subtype (H1N1 - 7 isolates , H1N2 - 1), 5 subtype H3N8, and only 3 viruses H2 subtype (H2N3 - 2 isolates, H2N? - 1). These viruses were isolated from wild waterfowl of two types - Mallard and Shelduck. H1 and H2 subtypes of Influenza viruses were identified during autumn migration and wintering only, H3 influenza virus - during autumn migration only. No virus was isolated during spring migration, nesting and after nesting movements. Conclusions Our results demonstrate that H1, H2 and H3 subtypes of AIV circulate widely in wild waterfowl. Particular attention should be paid to the circulation in natural settings of H2 influenza viruses which have not been reported in humans for many years. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P107 POSTE R A BSTRAC TS SPB4P03 Tissue distribution of low pathogenic avian influenza virus in naturally infected wild birds. Barral, Marta (1); Alvarez, Vega (1); Busquets, Nuria (2); Gerrikagoitia, Xeider (1); Minguijón, Esmeralda (1); Costa, Tania (2); Ramis, Antonio (2); Majo, Natalia (2) 1: NEIKER-Instituto Vasco de Investigación y Desarrollo Agrario. Derio-Bizkaia, Spain; 2: Centre de Recerca en Sanitat Animal (CReSA). BellaterraBarcelona, Spain Recent experimental infections with low pathogenic avian influenza virus (LPAIV) in birds have revealed interesting data about clinical outcome, pathogenesis and virus shedding, but to date, little is known about natural LPAIV infection in wild birds. The objective of this work was to gain knowledge about the pathogenesis of LPAIV infection in naturally infected wild birds. During the course of surveillance studies, we had access to sixty-one carcasses of wild birds that first resulted positive for avian influenza virus detection by real time RT-PCR when cloacal or oropharyngeal swab were analysed. The majority of them were ducks (88%), being mallard (Anas platyrhynchos) the most frequently studied species (N=42). A complete necropsy was performed and trachea, lung, thymus, liver, kidney, heart, brain and intestine tissues were systematically collected. Histopathology, immunohistochemistry and molecular detection of avian influenza virus by RT-PCR were carried out in collected tissue samples. In addition, RT-PCR positive tissues and cloacal or oropharyngeal swabs were inoculated in SPF embrionated chicken eggs for virus isolation and subtyping following specific RTPCR or sequencing. At least one tissue was RT-PCR positive in 20% of the animals. All analysed tissues from a yellow-legged gull were positive by RT-PCR. Attending to the type of surveillance, 35.7% of birds obtained by passive surveillance showed almost one positive tissue by RT-PCR, whereas only 6.1% were positive from those obtained by active surveillance (p<0.005). Histopathological findings included tracheitis or laryngitis in 12% of individuals and lesions due to coinfection with other avian pathogens. Regarding immunohistochemistry results, no positive reactions were observed in the studied animals. Virus isolation was obtained from 45.9% of the birds and 16 different virus subtypes were identified, being H4N6, H1N1, H8N4, H3N6 and H6N8 the most frequently found, but low pathogenic H5 and H7 subtypes were also detected. Virus detection in tissues was more frequent in birds found sick or dead suggesting a relation with other concomitant factors or pathogens. Further studies should be made in order to better understand the dynamics of LPAIV infection in their natural wild reservoirs. Work funded by Spanish National Institute for Agricultural and Food Research and Technology (INIA) (FAU200600019-C03 and RTA2011-00111-C03), Department of Agriculture and Fisheries (Basque Government) and Departament d’Agricultura, Ramadaria, Pesca, Alimentació i Medi Natural (Catalonia) TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P108 POSTE R A BSTRAC TS SPB4P04 Sero-prevalence of antibodies against H5N1 and H9N2 avian influenza viruses among Egyptians: Results of a prospective, controlled, seroepidemiological study. Kayali, Ghazi (1); Webby, Richard J (1); Ali, Mohamed A (2) 1: St. Jude Children’s Research Hospital, United States of America; 2: National Research Centre, Egypt Background The extent of human infection with avian influenza H5N1 viruses remains debatable. A meta-analysis of published sero-prevalence studies estimated that 1-2% of humans exposed to H5N1 are sero-positive. It concluded that a large number of mild and/or subclinical cases have been missed thus over-estimating the case fatality rate. Experts in the field responded that those findings have been over-interpreted since the analysis was based on limited and uncertain data. Egypt is an H5N1-endemic hotspot where most of the world’s recent human cases were reported. H9N2 viruses were detected in Egypt in 2011 and were found to co-circulate with H5N1, and co- infect the same avian host. In this country, we set out to determine the extent of human infections with avian influenza by determining the sero-prevalence of antibodies against these viruses and measuring the associated risk factors. Methods We conducted a prospective, controlled, sero-prevalence cohort study among 750 Egyptians exposed to poultry and 250 unexposed controls aged 2 and older. At baseline, we obtained a blood sample and completed a questionnaire assessing demographic, health, and exposure variables. Subjects were followed for 2 years and a blood sample was obtained annually. Sera were tested for antibodies against H5N1 and H9N2 viruses using a microneutralization assay. Titer of >1:80 was considered positive. Logistic regression was used to determine risk factors. Results At baseline, 2.1% of the exposed group tested positive for anti-H5N1 antibodies compared to 0% in the control group. In the follow-up years, the prevalence was 0.4% and 0.6% respectively in the exposed group and 0% in the control group but the difference was not statistically significant. Having chronic respiratory problems was significantly associated with infection (OR=12.6; 95% CI=3.8-41.7). At baseline, no significant difference was detected in antibodies against H9N2 viruses between the 2 groups (1.1% vs 0%). During the follow-up years, when H9N2 viruses were detected in Egypt, the sero-prevalence in the exposed group was 7.5% and 5.9% respectively, significantly different than that in the control group (0.7% and 1.0% respectively). Older age, exposure to ducks, and vaccinating poultry were associated with having antibodies against H9N2. Antibody titers against human influenza viruses was not correlated to testing positive to H5N1 and H9N2. Conclusions Our data indicate that in an endemic setting where exposure is high and continuous, serology can be useful in determining the extent of infection. In Egypt, 2% of the exposed had elevated antibody titers against H5N1, supporting the notion that many non-severe infections go undetected. We also show that H9N2 viruses are infecting humans in Egypt, and that infection with H9N2 is higher than that with H5N1. Avian influenza viruses continue to be a serious threat to public health in Egypt. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P109 POSTE R A BSTRAC TS SPB4P05 Serological monitoring of equine influenza after vaccination in Korea in 2013 Kim, Bo-Hye (1); Yang, Sunjoo (2); Kim, Eun-Ju (1); Shin, Ye-Jin (1); Song, Jae-Young (1); Shin, Yeun-Kyung (1) 1: Animal and Plant Quarantine Agency, Republic of Korea; 2: Korea Racing Authority, Gwacheon, Republic of Korea Background Equine influenza (EI) is an acute respiratory infection of horses, donkeys and mules caused by two distinct subtypes (H7N7 and H3N8) of influenza A viruses (1). Viruses of the H7N7 subtypes have not been isolated since the late 1970s (1). As a result of antigenic drift the H3N8 subtype evolved into several distinct lineages (Eurasian, American, Clade I, and Clade II). EI outbreaks have been reported all over the world with the exception of a few countries. EI is endemic in Europe and North America and is considered to be of potentially major economic significance to the equine industry (2). Rapid diagnosis, movement restrictions and vaccinations are the key control measures for EI. EI vaccines are widely available and are routinely used in competition horses in worldwide (1). Because of the antigenic differences among EI viruses, all equine influenza vaccines should contain epidemiologically relevant strains of EI viruses. Expert Surveillance Panel (ESP) reviews the EI outbreak and makes recommendation (1). Regular vaccination with proper strain is highly recommended since the disease can be spread quickly in the naïve susceptible populations. Serological monitoring of EI has been performed to evaluate the seroconversion rate after EI vaccination. Methods Equine serum samples were collected from horses maintained by Korea Racing Authority. Serum samples were collected two times in 2013; 348 horse sera were collected in April and May and 474 serum samples were collected between September and November. These horses have been regularly vaccinated against equine influenza. The virus strain, H3N8 Florida Clade II (A/EQ/WILDESHAUSEN/08) was used as antigens for Hemagglutination Inhibition (HI) test. The virus was kindly provided by Dr. A. Damiani from Institute of Virology, Veterinary Medicine, Free University of Berlin, Germany. The HI test was performed according to OIE Terrestrial Manual, Chapter 2.5.7. Results At baseline, 2.1% of the exposed group tested positive for anti-H5N1 antibodies compared to 0% in the control group. In the follow-up years, the prevalence was 0.4% and 0.6% respectively in the exposed group and 0% in the control group but the difference was not statistically significant. Having chronic respiratory problems was significantly associated with infection (OR=12.6; 95% CI=3.8-41.7). At baseline, no significant difference was detected in antibodies against H9N2 viruses between the 2 groups (1.1% vs 0%). During the follow-up years, when H9N2 viruses were detected in Egypt, the sero-prevalence in the exposed group was 7.5% and 5.9% respectively, significantly different than that in the control group (0.7% and 1.0% respectively). Older age, exposure to ducks, and vaccinating poultry were associated with having antibodies against H9N2. Antibody titers against human influenza viruses was not correlated to testing positive to H5N1 and H9N2. Results and Conclusion In HI test using Clade II H3N8 virus as antigen of HI test, seropositive percentage was 81.3 among 348 serum samples from the first half year; the horse sera collected in the second half showed 98.3. It could be presumed that horses tested in this study were vaccinated with epidemiologically relevant EIV strains. References 1. Equine influenza, Chapter 2.5.7. OIE Terrestrial Manual 2012. 2. Equine Influenza – A global perspective. Veterinary Microbiology. 167 (2013) 205~214 TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P110 POSTE R A BSTRAC TS SPB4P06 Monitoring Avian Influenza Virus in a small Spanish wetland using noninvasive sampling methods. Torrontegui, Olalla (1); Álvarez, Vega (1); Gerrikagoitia, Xeider (1); Höfle, Ursula (2); Barral, Marta (1) 1: NEIKER-Instituto Vasco de Investigación y Desarrollo Agrario, Derio-Bizkaia, Spain; 2: Instituto de Investigación en Recursos Cinegéticos IREC (CSIC, UCLM, JCCM) Ciudad Real, Spain Anseriformes and Charadriiformes are known to be the main reservoirs for Avian Influenza Virus (AIV) in which the transmission within these occurs via faecal/oral contact in contaminated water. Understanding the Avian Influenza Virus (AIV) persistence and transmission dynamics is crucial for predicting disease outbreaks and improving surveillance strategies. The aim of this work was to monitor the presence and persistence of AIV in its natural environment in relation to ecology of its reservoir hosts. During a 23 month period (March 2012-January 2014) the relationship between AIV presence and wildfowl population movements was studied in a small wetland in the north of Spain where the presence of different AIV had previously been recorded. This water ecosystem is considered of special interest as it is an important site for wintering and breeding of waterfowl and as a stopover for waterfowl migrating further south, being considerably small (209 Ha) and close to an urbanised area. Fresh faeces were collected monthly from islets scattered along the wetland, used as roosting sites by the birds. Bird censuses and meteorological data were gathered in parallel in order to relate AIV detection to waterfowl ecology. For AIV detection RNA was extracted from the faecal matter and analysed by influenza A specific rRT-PCR. Positive samples were then tested for H5 and H7 subtypes and inoculated into embrionated SPF chicken eggs for virus isolation. During the 23 months, a total of 2096 samples were analysed and AIV was detected in 0.29%. In regard to the wild bird population movements, the highest AIV prevalence occurred along the breeding season (0.67%) and autumn migration (0.35%). The highest prevalence 3.23% was recorded in June 2012. All positive samples contained low pathogenic AIV. The concentration of positive results during the two above mentioned periods may be related to two scenarios in waterfowl ecology; on one hand, high water bird aggregation densities and therefore a greater virus titre input to the environment during migration and fledging of chicks and on the other hand, the presence of a naïve juvenile population with a still less efficient immune system that will make them more susceptible towards an AIV infection. More research is deemed necessary clarify the complex AIV ecology. In this regard, further studies are presently being undertaken. Work funded by Spanish National Institute for Agricultural and Food Research and Technology (INIA) (RTA201100111-C03-03) and Department of Agriculture and Fisheries (Basque Government). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P111 POSTE R A BSTRAC TS SPB4P07 Influenza A(H1N1)pdm09 virus in pigs, Togo, 2013 Ducatez, Mariette (1); Webby, Richard (2); Awoume, Félix (3) 1: INRA, France; 2: Department of Infectious Diseases, St Jude Children’s Research Hospital, Memphis, TN, USA; 3: Laboratoire National Vétérinaire de Lomé, Lomé, Togo After Togo underwent a couple of outbreaks of highly pathogenic avian influenza H5N1 in 2007 and in 2008, a large scale active surveillance study of animal influenza has been carried out from 2009 through 2014 with close to 10,000 avian and swine swabs tested for the presence of influenza virus genome. As observed in the neighboring Benin and Côte d’Ivoire, none of the animal swabs collected in Togo through 2012 had been positive for influenza A virus (irrespective of the subtype), nor had any animal serum tested positive for influenza antibodies (CouacyHymann et al, EID, 2012). We have previously hypothesized that the combination of climate and animal density factors might be responsible for what appeared to be the absence of influenza virus in the backyard sector of Côte d’Ivoire, Benin, and Togo. From February through November 2013, influenza virus has been detected in swine from a slaughterhouse near Lomé in Togo. 270 nasal swabs were collected from freshly slaughtered healthy pigs throughout the year. The samples were kept at 4°C in virus transport medium for a few hours and stored at -80°C until further analyzed. They were then pooled (5 samples per pool), RNA was extracted and influenza A specific RT-PCR was carried out. Eight pools (15% of the pools) were positive for influenza A genome, which corresponds to a virus prevalence of 3 to 15%. Subtyping PCRs were carried out and allowed the identification of the A(H1N1)pdm09 virus in all the influenza A positive pools. We successfully isolated virus on MDCK cells from a representative specimen and confirmed by Sanger sequencing that it harbored 8 genes very similar to A(H1N1)pdm09 viruses circulating in human in 2013. While very little was known on swine influenza viruses in Africa until 2009, A(H1N1)pdm09 became pandemic in human and emerged in swine in La Réunion Island in 2009 (Cardinale et al, EID, 2012), in Cameroon in 2010 (Njabo et al, Vet Microbiol, 2010), and in Nigeria in 2010 (Meseko et al, Vet Microbiol, 2014). We observe a delay in A(H1N1)pdm09 emergence in pigs in Togo, emergence likely due to human to swine transmission. Further studies are ongoing to assess the burden of the disease in swine in Togo. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P112 POSTE R A BSTRAC TS SPB4P08 Long term surveillance of H7 influenza viruses in American wild aquatic birds: Concordance with emergence of variants with pathogenic potential? Krauss, Scott L. (1); Webster, Robert G. (1); Danner, Angela (1); Friedman, Kimberly (1); Knowles, James (1); Ghazi, Kayali (1); Niles, Lawrence J. (2); Dey, Amanda D. (3); Raven, Garnet (4); Pryor, Paul (4); Stucker, Karla (5); Schobel, Seth (5); Stockwell, Timothy B. (5); Lin, Xudong (5); Wentworth, David (5) 1: St. Jude Children’s Research Hospital, Department of Infectious Diseases, Memphis, Tennessee, United States of America; 2: Conserve Wildlife Foundation of New Jersey, Bordentown, New Jersey, USA; 3: Endangered and Nongame Species, New Jersey Division of Fish and Wildlife, Trenton, New Jersey, USA; 4: Environment Canada, Canadian Wildlife Service, Edmonton, Alberta, Canada; 5: J. Craig Venter Institute, Rockville, Maryland, USA The emergence of influenza viruses in domestic avian species and associated transmissions to mammals, including swine and humans, is currently unpredictable. Of current concern are the H7 influenza viruses where the H7N3 subtype has become highly pathogenic for poultry with occasional human infections in 4 separate outbreaks in North and South America from 2002 to 2012. In addition low pathogenic H7N9 viruses in poultry have emerged in China and are highly pathogenic in humans. Here we use long term surveillance for influenza viruses from North America in shorebirds at Delaware Bay, USA (1985‐2012) and from ducks in Alberta, Canada (1976‐2012) to determine whether shorebirds or ducks have potential for interspecies transmissions, and whether surveillance in wild birds has any predictive value. For H7 influenza viruses shorebirds carried the majority of possible HA NA combinations ‐ 8 of the 9 neuraminidases subtypes found in aquatic birds in the Americas were detected in shorebirds while 6 of 9 neuraminidases were found in ducks. The most frequent combination was H7N3 which was found in both shorebird and duck species but more frequently in shorebirds. Overall there was concordance between the peaks of activity of low pathogenic H7N3 in wild birds and with the 4 outbreaks of highly pathogenic H7N3 in the Americas. Phylogenetic analysis of the virus genomes shows that each of the 4 HPAI outbreaks of H7N3 in the Americas represents a separate introduction of low pathogenic avian influenza to poultry from the wild aquatic bird reservoir ‐ most likely from dabbling ducks. The outbreak of HPAI H7N3 in Chile in 2002 was generated by precursor viruses distinct from low pathogenic avian influenza strains found in North America. Thus, enhanced biosecurity on poultry farms, coupled with the potential forewarning of veterinary and public health officials by detection of increased activity of H7N3 influenza viruses in wild aquatic birds, could prevent emergence of highly pathogenic avian influenza. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P113 POSTE R A BSTRAC TS SPB4P09 Prior infection of pigs with a European H3N2 SIV confers partial protection against a North American swine-origin H3N2v influenza virus QIU, YU; Mancera Gracia, José Carlos; Li, Yewei; Trus, Ivan; Nguyen Van, Ut; Van Reeth, Kristien Department of Virology, Parasitology and Immunology, Faculty of Veterinary Medicine, Ghent University, Belgium Background H3N2 swine influenza virus (SIV) lineages in Europe and North America have distinct HA and NA genes that are derived from human H3N2 viruses from the 1970s and 1990s, respectively. Of the multiple H3N2 genotypes that circulate among US swine, one particular genotype - a reassortant with only the matrix gene from the 2009 pandemic H1N1 virus - has caused 340 human infections in 2011-2013. This H3N2 “variant” (H3N2v) virus and other North American H3N2 SIVs have so far never been reported in Europe. This raises the question as to whether pigs immune to the antigenically and genetically distinct European H3N2 SIVs would be protected against infection with H3N2v if H3N2v were introduced in Europe. Methods Conventional 8-week-old influenza naïve pigs were inoculated intranasally with the H3N2v virus A/Indiana/08/11 (In/11-In/11 group), with the European H3N2 SIV sw/Gent/172/08 (Gent/08-In/11 group), or with phosphate buffered saline. Eight weeks later, all pigs were challenged intranasally with A/Indiana/08/11. Both H3N2 viruses have only 80% homology in their HA1 and all but the matrix gene segments have a phylogenetically distinct origin. The extent of protection against challenge was determined by virus titration of nasal swabs (0-7 days post challenge), lung, trachea and nasal mucosa (3 days post challenge). Serum antibody responses were measured by hemagglutination-inhibition and virus-neutralization assays. Mononuclear cells from the nasal mucosa, tracheobronchial lymph nodes and peripheral blood were examined for virus-specific IgG and IgA antibody secreting cells (ASCs) and IFN-γ secreting cells (SCs) by ELISPOT assays. Results After the primary inoculation with A/Indiana/08/11 or sw/Gent/172/08, all pigs had high virus titers in nasal swabs for 5-6 days. There was no or minimal serological cross-reactivity between both H3N2 viruses. After challenge with A/Indiana/08/11, all challenge controls shed high amounts of virus for 6 days. Virus excretion was undetectable in the In/11-In/11 group and significantly reduced in both magnitude and duration (3-4 days) in the Gent/08-In/11 group. Virus titrations of the respiratory tract tissues are pending. At challenge, the numbers of A/Indiana/08/11specific IgA and IgG ASC, but not IFN-γ SCs, were significantly higher in A/Indiana/08/11 pre-infected pigs than in sw/Gent/172/08 pre-infected pigs. After challenge, the Gent/08-In/11 group showed vigorous early IgG and IgA ASC recall responses to A/Indiana/08/11, which were by far most pronounced in the nasal mucosa and associated with the shorter duration of nasal virus shedding. IFN-γ SC responses were boosted in the In/11-In/11 group but not in the Gent/08-In/11 group. Conclusions There is partial cross-protection between the European H3N2 SIV lineage and the H3N2v virus, which may be due to cross-reactive B cell responses in the nasal mucosa. The pig is a valuable model to study mucosal immune responses and to improve our understanding of broad-spectrum immunity to influenza. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P114 POSTE R A BSTRAC TS SPB4P10 Biosecurity practices in small commercial poultry farms, Bangladesh 2011-12 Rimi, Nadia Ali; Sultana, Rebeca; Muhsina, Mushtari; Uddin, Baktiar; Haider, Najmul; Nahar, Nazmun; Sturm-Ramirez, Katharine; Luby, Stephen P. icddr,b, Bangladesh Background In Bangladesh, highly pathogenic avian influenza is endemic. Small scale poultry farms account for 262/543 confirmed outbreaks among commercial farms. Biosecurity measures may reduce the spread of avian influenza. This study aimed to understand the biosecurity practices of small commercial poultry farmers. Methods During 2011-12, the research team conducted 57 hours of observations, 16 in-depth interviews and two group discussions with poultry farmers in 16 small commercial farms from two districts to understand the practices for three principle elements of biosecurity— segregation, cleaning and disinfection. We reviewed and summarized emerging themes. Results None of the farms were segregated from the environment, people and animals. None maintained recommended distances from the nearest households (median 6.7m, [IQR 1.65m-25.9m]; recommended: 500m), other poultry farms (median 30.5m, [IQR 7m- 91.95m]; recommended: 200m), large trees (median 0m; recommended: 100m) or roads (median 14.5m, [IQR 9m-41.35m]; recommended: 500m). Only one farm had intact fencing around all sides of the poultry shed. People (other than the farmers), backyard poultry, and other birds were observed frequently entering sheds. Farmers separated sick from well-appearing poultry inside sheds or bedrooms. Farmers, however, did not allow the buyer’s to bring egg trays inside their sheds. Five farmers reported sleeping inside the shed at night to protect chickens from rodents and foxes. Farmers used several locally available disinfectants to protect chickens from disease. All the farmers reported cleaning and disinfecting sheds by spreading lime on the floor before buying chicks. Six farmers reported spraying disinfectant inside and/or outside the shed daily. Four farmers reported sweeping away feces daily but none was observed using any disinfectant on the floor after feces removal. All farmers sold or used the feces as fish-feed without first treating it. Nine farmers used designated footwear for the shed. Two farms had footbaths which were not used during our observation. Of the 94 times farmers entered sheds, the team observed handwashing with soap by one farmer before entering and by two farmers after touching feces, and three farmers disinfecting their feet before entering. Farmers were never observed using masks or gloves and changing clothes before entering the shed. The farmers mentioned financial constraints and inconvenience as reasons for not complying with certain biosecurity measures. Conclusions While we seldom observed flock segregation or farmers’ handwashing and using personal protective equipment, some farmers used several measures that involved additional cost or effort, such as using disinfectants or separate footwear for the shed and restricting buyer’s egg trays from entering the shed to protect their flock. This suggests that farmers could be motivated by interventions that protect their investment. Future interventions could explore the feasibility, desirability and effectiveness of low- cost alternatives such as locally available fencing materials and disinfectant agents. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P115 POSTE R A BSTRAC TS SPA5: VACCINES: CURRENT AND NOVEL APPROACHES SPA5P01 Multi-component adjuvants for inactivated influenza vaccines: comparative studies in a preclinical setting Vasiliev, Y.M.; Kashirina, O.S.; Chernikova, M.I. Mechnikov Research Institute of Vaccines and Sera, Russian Federation Background Influenza remains a global healthcare issue. Vaccines are the cornerstone of influenza prevention and control. Adjuvants can boost immunogenicity of prepandemic and seasonal influenza vaccines. Novel adjuvants for influenza vaccines could be based on depot-forming and immune stimulating components with an optimal safety and immunogenicity profile (for individual components). Some of these components include chitosan-based formulations and well-known adjuvants (aluminium hydroxide, CpG). Methods Groups of mice were immunized intramuscularly once or twice with adjuvanted inactivated whole-virion monovalent influenza vaccines based on A/California/07/2009 X-179A (H1N1) strain. Immunogenicity was evaluated by HAI and MN (in MDCK cells) sera antibodies against the vaccine and drift A/Brisbane/59/2007 IVR-148 (H1N1) strain. In the first series of experiments a panel of commercially obtained chitosan- based adjuvants (different molecular weight (Mw, Mn and/or Mv), viscosity and/or deacetylation degree) was studied (14 groups in total). In the second series of experiments a panel of multi-component adjuvants as well as individual components (including aluminium hydroxide, CpG, oil-in-water emulsions) were studied (19 groups in total). Results In the first series of experiments different chitosan-based adjuvants increased immunogenicity of the influenza vaccine in varying patterns. The most immunogenic and a non-immunogenic (negative control) chitosan-based adjuvants was selected for further studies. In the second series of experiments different adjuvants increased immunogenicity of the influenza vaccine in varying patterns. A chitosan-based adjuvant was the most immunogenic (antibody titers in some cases increased by 50 times compared with the unadjuvanted vaccine), highly immunogenic 2- and 4-component adjuvants as well as a 5-component oil-in-water emulsion were identified. Interestingly, a chitosan-based adjuvant that was not immunogenic (negative control) potentiated the immunogenicity of a multicomponent adjuvant. Immunogenicity of the vaccine against the drift strain was very low regardless of the adjuvant used. Conclusions Some of the multi-component adjuvants (depot-forming and immune stimulating components) significantly increase immunogenicity of the intramuscularly administered inactivated influenza vaccine, further preclinical studies elucidating mechanisms of action, optimal composition and safety are necessary. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P116 POSTE R A BSTRAC TS SPA5P02 Characteristics of chitosan-based adjuvants determine immunogenicity of inactivated influenza vaccines in mice Khasanova, L.M. (1,2); Kashirina, O.S. (1); Chernikova, M.I. (1); Vasiliev, Y.M. (1) 1: Mechnikov Research Institute of Vaccines and Sera, Moscow, Russian Federation; 2: Centre “Bioengineering”, Moscow, Russian Federation Background Vaccination is the principal approach for influenza control. Immunogenicity of inactivated influenza vaccines is suboptimal and addition of adjuvants has been suggested. However adjuvants with an optimal safety and effectiveness as well as cost-effectiveness profile are currently lacking. Chitosan has been studied for various biotechnology and biomedicine applications. Principle chitosan characteristics include deacetylation degree (DD), molecular mass (Mm), polydispersion and source (e.g. shrimp, crab, fungi). Lack of chitosan characteristics in published preclinical and clinical studies prevents conclusions regarding adjuvant properties for influenza vaccines. Methods A panel of characterized chitosan-based adjuvants was used. Chitosan substances with Mm of 700, 200, 10 kDa, DD 85%; 200 kDa, DD 68% and 10 kDa, DD 98% and a succinylated chitosan were laboratory-produced, commercial substances were obtained via Sigma-Aldrich, USA. Average viscous (Mv) molecular weight was determined by capillary viscometry, weight average (Mw) and number average (Mn) molecular weight - by GPC, DD - by conductometric titration and 1H NMR spectroscopy for all the chitosan substances. Groups of mice (15 in total) were immunized intramuscularly once and twice with adjuvanted monovalent inactivated whole-virion influenza vaccines against A/ California/07/2009 X-179A (H1N1) strain. Immunogenicity was evaluated by sera hemagglutination inhibiting (HAI) and neutralizing (MN in MDCK) antibodies against the vaccine and an antigenically distinct (A/Brisbane/59/2007 IVR-148 (H1N1)) strain. Results Adjuvants based on chitosan substances with different characteristics increased immunogenicity of the inactivated influenza vaccine in varying patterns. Both DD and Mm had a significant effect on adjuvant properties of chitosanbased formulations. 700 kDa, 85% DD chitosan-based adjuvant was one of the most immunogenic, whereas immunogenicity of adjuvants based on a low molecular weight chitosan (10 kDa, 85% DD) compared with high molecular weight chitosans (200 and 700 kDa, 85% DD) was significantly lower (up to 3 and 7 times, respectively). Conclusions Further studies regarding the role of characteristics of chitosan-based adjuvants in immunogenicity of various inactivated influenza and other vaccines are necessary. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P117 POSTE R A BSTRAC TS SPA5P03 A comparative study of adjuvants with different mechanisms of action for influenza vaccines in mice Chernikova, M.I. (1); Kashirina, O.S. (1); Khasanova, L.M. (1,2); Vasiliev, Y.M. (1) 1: Mechnikov Research Institute of Vaccines and Sera, Moscow, Russian Federation; 2: Centre “Bioengineering”, Moscow, Russian Federation Background Influenza is one of the most common respiratory infectious diseases and is associated with high morbidity, mortality and pandemic potential. Vaccination is one of the most effective approaches to prevent and control influenza. Inactivated influenza vaccines are the most widely administered worldwide, however immunogenicity in risk groups and against antigenically distinct strains is suboptimal. Adjuvants can increase immunogenicity of inactivated influenza vaccines, however the search for effective, safe and affordable adjuvants is an ongoing challenge complicated by a lack of data from direct comparative studies of adjuvants with different mechanisms of action. Methods A panel of adjuvants was used: aluminium hydroxide, calcium phosphate, polyoxidonium, complete Freund’s adjuvant (CFA), oligodeoxynucleotide CpG, cholera toxin subunit B (CTB), monophosphoryl lipid A (MPL), peptidoglycan, poly-(lactide co- glycolide) [PLG], saponin, arabinogalactan as well as adjuvants based on characterized chitosan substances (chitosan lactate, chitosan glutamate and oligochitosan glutamate solutions), an oil-in-water emulsion and a multi-component formulation. Unimmunized mice, PBS, chicken embryo allantoic fluid (non-purified antigen) and a live virus (model infection) were used as controls. Groups of mice (21 in total) were immunized intramuscularly once or twice with adjuvanted inactivated whole-virion influenza vaccines based on A/California/07/2009 X-179A (H1N1) strain. Immunogenicity was evaluated by sera hemagglutinin-inhibiting and neutralizing antibodies against the vaccine and an antigenically distinct (A/Brisbane/59/2007 IVR- 148 (H1N1)) strain. Results Adjuvants with different mechanisms of action increased immunogenicity of the vaccine in varying patterns. Immunogenicity against the antigenically distinct strain was very low regardless of the adjuvant used. Chitosan lactate, oil-in-water emulsion and the multi-component formulation were the most immunogenic. Chitosan glutamate and CTB were very highly immunogenic, and PLG, CFA and oligochitosan were highly immunogenic. Conclusions Chitosan-based adjuvants are promising candidates for influenza vaccines, however role of chitosan characteristics and/or form (e.g. solution) in mechanisms of action should be further elucidated. Direct comparative studies provide the basis for evaluation of novel as well as selection of optimal adjuvants for influenza vaccines. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P118 POSTE R A BSTRAC TS SPA5P04 Epidemiologic performance and influenza vaccination prophylaxis in Russia Briko, Nikolay Ivanovich I.M. Sechenov First Moscow Government Medical University, Russian Federation Background Analysis of influenza epidemiologic performance (morbidity rate, age pattern, seasonal fluctuation) and vaccination prophylaxis status in the country. Methods Infection morbidity official data (F.2, approved by Rosstat) together with vaccination coverage statistical data (F.5, approved by Rosstat), and scientific Russian literature publications were studied. Results In Russia, 20-25 mln. cases of morbidity with influenza and ARVIs are registered annually. Morbidity dynamics involves case rates elevation and decline. In 2011, 308 829 cases of influenza were registered (217,6 per 100 000 of population); in 2013 this value was to be 100 642 (70,4 per 100 000 of population). From them, pediatric population comprised 38416 (145,6 per 100 000 of population). Economic loss from influenza and ARVIs provides about 77% from total loss resulting from general infection diseases morbidity rate. In total temporary incapacity cases cohort, influenza and ARVIs take 12–14%. Generally, in the period of 2005-2013 morbidity increase begins in December achieving the maximum in February, and completed in April. Influenza morbidity high risk groups include pediatric collectives of 1-2 years old, children of 3-6 years old, and elderly. In the season 2012-2013, simultaneous circulation for influenza virus strains А (H3N2), A (H1N1), А(Н1N1)2009 and В was registered. Influenza vaccination is a part of National Immunization Schedule, both for children from 6 months old, schoolchildren, and students, and for adults as well. Since 2014, influenza vaccination is recommended for pregnant. Last 5 years, influenza vaccination coverage in Russia grew up in 1.6 times. In 2013, 27.8% from all population was vaccinated (39 713 587). Vaccination coverage in organized pediatric cohorts was 64 % (WHO recommends 75%). Conclusions Influenza and ARVIs bring significant social-economic loss due to high spread ability. To increase the influenza vaccination coverage, more intensive information and public awareness activity is necessary, both in the form of community outreach, and for medical professionals. Besides, it is necessary to engage extra-budgetary and nonstate and resources widely (insurance payments, charity funds, institutions and enterprises resources, citizens’ personal finances). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P119 POSTE R A BSTRAC TS SPA5P05 Comparison of immune response induced by candidate recombinant influenza vaccines based on heterologous M2e linked to full-length and truncated forms of flagellin Stepanova, Liudmila (1); Kotlyarov, Roman (2); Kovaleva, Anna (1); Potapchuk, Marina (1); Korotkov, Alexandr (1); Sergeeva, Maria (1); Kasianenko, Marina (1); Kuprianov, Victor (2); Ravin, Nicolai (2); Tsybalova, Liudmila (1) 1: Research Institute of Influenza, Ministry of Health of the Russian Federation, St. Petersburg, Russia, Russian Federation; 2: Centre “Bioengineering”, Russian Academy of Sciences, Moscow, Russia Background Flagellin protein presents the appropriate platform for development of recombinant vaccines against various pathogens of viral and bacterial origin. Being the major structural protein of gram-negative bacteria flagellin exhibits strong adjuvant properties when administered together with foreign antigens by parenteral, mucosal or subcutaneous route. The ability of flagellin to be both a platform and an adjuvant for vaccine development was demonstrated for various model infections including influenza. In this study we compared immune response and protection of recombinant proteins where heterologous M2e were linked with full-length or truncated forms of flagellin. Methods Recombinant proteins were generated by fusion of two tandem copies of consensus M2e sequence from human influenza A viruses (M2eh) and two copies of M2e from A/H5N1 (M2ek) to C-terminus of full-length flagellin (Flg2M2eh2M2ek) or truncated form of flagellin with deletion of hypervariable (154-431aa) part (Flg(sh)-2M2eh2M2ek). Balb/c mice were immunized intranasal 3 times at 2-weeks intervals with 30 μg of recombinant proteins. AntiM2e IgG, IgG1, IgG2a in serum and sIgA, IgG in bronchoalveolar lavage (BAL) were determined by ELISA. Sera of immunized mice were tested for reactivity with MDCK cells infected by influenza A viruses. Immunized mice were challenged with 1 LD50 A/PR/8/34 (H1N1) and monitored daily for 2 weeks for survival and weight loss. Results We demonstrated that intranasal immunization of Balb/c mice with both recombinant proteins Flg-2M2eh2M2ek and Flg(sh)-2M2eh2M2ek resulted in similar antibody response to M2eh and M2ek (p>0.05) in serum and BAL. Meanwhile it was not significant differences in titers of anti-M2e antibodies post immunization with Flg2M2eh2M2ek and Flg(sh)-2M2eh2M2ek (p>0.05). Intranasal immunization led to generation of specific IgG1 and IgG2a, with predominant IgG1 (p<0.05), that suggested Th2-type immune response. Induced anti-M2e antibodies Th2-type immune response. Induced anti-M2e antibodies recognized nativecells M2einfected with A/PR/8/34 (H1N1) and A/ recognized native M2e epitopes exposed on the surface of the MDCK epitopes exposed on the surface of the MDCK cells infected with A/PR/8/34 (H1N1) andof mice with recombinant proteins (FlgKurgan/05/05 RG (H5N1). Our results demonstrated that immunization A/Kurgan/05/05 RG (H5N1). Our results demonstrated that immunization of mice with 2M2eh2M2ek and Flg(sh)-2M2eh2M2ek) resulted in equal protection (90-100% survival), significantly less weight recombinant proteinsmice (Flg-2M2eh2M2ek Flg(sh)-2M2eh2M2ek) resulted in equal loss ) than control after lethal and challenge with A/PR/8/34 (H1N1). Immunized mice experienced significant protection (90-100% survival), significantly less weight loss ) than control mice after (table 1). decrease lung viral titers than control mice (p<0.01) at 6th day post challenge lethal challenge with A/PR/8/34 (H1N1). Immunized mice experienced significant th day post challenge (table 1). decrease lungtiters viral titers than control (p<0.01) at 6 challenge Table 1. Viral in mouse lungmice at 6th day post th Table 1. Viral titers in mouse lung at 6 day post challenge immunized mice Flg-2M2eh2M2ek Flg(sh)-2M2eh2M2ek PBS (control) influenza virus А/PR/8/34 1 LD50 А/PR/8/34 1 LD50 А/PR/8/34 1 LD50 log10 TCID50 1,95±1,2 (р<0,01) 1,4±0,9 (р<0,01) 4,45±0,8 Conclusion. The results show the prospects for development of candidate influenza vaccine based on truncated form of flagellin and heterologous M2e peptides with broad spectrum recognition of influenza A viruses of distinct origin. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P120 POSTE R A BSTRAC TS Conclusions The results show the prospects for development of candidate influenza vaccine based on truncated form of flagellin and heterologous M2e peptides with broad spectrum recognition of influenza A viruses of distinct origin. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P121 POSTE R A BSTRAC TS SPA5P06 A Novel Influenza Vaccination Strategy based on DNA vaccines encoding M2 ectodomain fused with adjuvant proteins against Pandemic Influenza Viruses Yi, Hwajung; Seo, Ki-Weon; Lee, Mi-Seon; Kang, Chun; Kim, Kisoon Korea National Institute of Health, Korea Centers for Disease Control and Prevention Background There has been a growing concern about continuous risk of emerging novel influenza viruses, such as the 2009 pandemic and human infection of avian influenza viruses. Against the pandemic, it is essential to develop and provide the influenza vaccines rapidly to the public. However, current influenza vaccines are only effective against a narrow range of influenza strains and need at least 6 months for development and public-distribution for timeliness of pandemic preparedness. Thus, novel vaccine techniques of rapid response to newly emerged influenza viruses are required. Methods With advantages of DNA vaccine strategy, series of triple heterologous M2e (M2 ectodomain is highly conserved region between influenza strains) derived from human, avian and swine influenza viruses into pCAG-EN vector conjugated with various adjuvants (Flagellins, tetanus toxin C fragment, RSV-G proteins, E. coli endotoxin LTB, Cholera toxin A and B subunits) were prepared and evaluated their immunogenicity. Results After confirming the expressions of the M2e series encoded in pCAG-EN in 293T cells by transfection, it was observed that the thrice immunization of the M2e DNA vaccines into mice could induce the M2e specific antibodies. The immunization of the M2e series into mice also elicited protective immunity against lethal infection of A/PR8/1934. Moreover, it was shown that the M2e DNA vaccination conjugated with flagellin and LTB impose mice to more efficient protection against the PR8 infection. Conclusions Only 7 weeks from the design and cloning of M2e series by gene-synthesis into DNA vaccine vector to the confirmation of vaccine effectiveness to the influenza viruses were taken. These data suggests that DNA vaccine strategy would be alternative to overcome limitation of the current vaccines based on influenza virus growing in eggs or animal cells. This work was supported by intramural fund (#2013-NG43003-00) of the NIH, Korea. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P122 POSTE R A BSTRAC TS SPA5P07 Humoral immunity induced by seasonal influenza vaccine in humans protects against H5N1 challenge in mice Roozendaal, Ramon; Tolboom, Jeroen; Roos, Anna; Riahi, Sarra; Theeuwsen, Jessica; Bujny, Miriam V.; Klaren, Vincent; Korse, Hans J.W.M.; Dekking, Liesbeth; Grootenhuis, Arijan; Weverling, Gerrit Jan; Koudstaal, Wouter; Goudsmit, Jaap; Radošević, Katarina Crucell Vaccine Institute, Janssen Center of Excellence for Immunoprophylaxis Background The search for vaccines that provide ‘universal’ protection against influenza has been fueled tremendously by the identification of broadly influenza neutralizing antibodies (bnAbs). The isolation of bnAbs from humans recently vaccinated with conventional influenza vaccines suggests that such vaccines could, in principle, elicit broadly protective immunity. To assess the potential of seasonal influenza vaccine to induce broad protection against influenza we established a novel human-to-mouse serum transfer and challenge model. Methods Human subjects in a vaccine safety and immunogenicity trial (INF-V-A017) were immunized three times in total with a seasonal influenza vaccine. Serum samples were collected immediately prior to and one month after each vaccination. Passive transfer of human serum into naïve mice was subsequently followed by a lethal challenge of an either homologous or avian influenza strain. In parallel, we performed serological assays on human serum samples to determine the titer of functional virus-reactive antibodies and examined to what extent these were correlated to protection induced by the corresponding serum. Results We showed that passive protection of mice with serum from vaccinated humans recapitulates relevant features of human protection against vaccine homologous influenza strains. Notably, protection against homologous H1N1 influenza was strongly correlated to challenge strain specific HAI and virus neutralization. Moreover, vaccination of healthy adults induced humoral protection against highly pathogenic avian influenza of the H5N1 subtype. This protection could not be detected nor accurately predicted by any of the in vitro immunogenicity assays performed. Conclusions This study demonstrates the ability of the humoral response induced by seasonal vaccine in humans to confer protection against H5N1 influenza challenge in mice. The human-to-mouse serum transfer and challenge model described can be used to assess the protective ability of vaccines in the absence of known in vitro correlates of protection, and aid the development of ‘universal influenza vaccines’. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P123 POSTE R A BSTRAC TS SPA5P08 Humoral protection against H5N1 influenza by multiple immunizations with seasonal influenza vaccine in mice Roos, Anna; Roozendaal, Ramon; Theeuwsen, Jessica; Riahi, Sarra; Vaneman, Joost; Tolboom, Jeroen; Koldijk, Martin; Dekking, Liesbeth; Koudstaal, Wouter; Goudsmit, Jaap; Radošević, Katarina Crucell Vaccine Institute, Janssen Center of Excellence for Immunoprophylaxis Background The development of an influenza vaccine which confers protection against a wide range of influenza viruses is of great importance. Current seasonal influenza vaccines are believed to confer protection against a narrow range of virus strains. However, isolation of broadly neutralizing antibodies from humans recently vaccinated with conventional influenza vaccines suggests that the current vaccines may elicit a broader range of immune reactivity than anticipated. In the current study we evaluate the ability of a seasonal trivalent influenza vaccine to elicit broad protection against influenza challenge in mice and further investigate potential in vitro correlates of such protection. Methods BALB/c mice were immunized using different vaccination regimens composed of single or multiple immunizations with seasonal influenza vaccine, or passively immunized by transfer of immune serum. Final immunization or transfer was followed by a lethal challenge of homologous and avian influenza strains. Challenged mice were monitored for survival, weight loss and clinical signs for 21 days. Antibody titers were determined in immune serum and pre- challenge serum of mice after passive transfer and correlated to protection. Results Mice immunized with multiple shots of vaccine showed significant survival against heterosubtypic H5N1 influenza. Immune serum obtained after three shots of vaccine induced a level of survival comparable to active immunization. Cross-reactive neutralizing antibodies were not detectable for any of the vaccination regimens. Protection against H5N1 challenge correlated with the level of vaccine-induced rH5 cross-reactive binding antibodies. Conclusions Our results demonstrate that repeated vaccination with a seasonal influenza vaccine broadens its range of protection. Using passive transfer we show that humoral immunity is correlated to protection while virus neutralizing antibodies are not detectable. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P124 POSTE R A BSTRAC TS SPA5P09 Improved vaccine-induced immune responses to influenza antigens. Gilbert, Sarah Catherine (1); Antrobus, Richard D (1); Berthoud, Tamara K (1); Mullarkey, Caitlin E (1); Hoschler, Katja (2); Coughlan, Lynda (1); Lambe, Teresa (1); Tully, Claire (1); Zambon, Maria (2); Hill, Adrian VS (1) 1: The Jenner Institute, University of Oxford, UK; 2: Respiratory Virus Unit, Public Health England, London, UK Background The efficacy of influenza vaccines in adults aged over 65 years is much debated, but is significantly lower than efficacy in younger adults, and may also decline before the end of the influenza season leaving vaccinated adults vulnerable to a late surge in infections. Increasing vaccine efficacy in this age group could have a major public health benefit. Attempts to improve efficacy have concentrated on increasing humoral responses to haemagglutinin (HA) and have so far had little impact on efficacy. T cell responses to influenza antigens are known to be important in protection against influenza in this age group, and we tested a method of boosting T cell responses to conserved influenza antigens at the same time as inducing improved humoral responses to Trivalent Inactivated Vaccine (TIV). Methods MVA-NP+M1 is a replication-deficient viral vector expressing influenza nucleoprotein and matrix protein 1. We vaccinated nine healthy volunteers (mean age 63.8 years) who had not received TIV that season with two vaccines, TIV and MVA-NP+M1, and a further eight (mean age 59.6 years) with TIV plus saline placebo. We then measured humoral responses to the three components of TIV by HI titre, and T cell responses to NP and M1 by interferongamma ELISpot assay. Results Co-administration of the two vaccines was well tolerated. The group receiving MVA- NP+M1 had significant increases in T cell responses to NP and M1 whereas only very minor and transient responses were detected after TIV with saline. HI titres to both influenza A components of the TIV were increased more from pre-vaccination levels in volunteers receiving MVA-NP+M1 with TIV. Conclusions Increasing T cell responses to conserved influenza antigens may have greater impact on influenza vaccine efficacy than increasing humoral responses to HA alone. Co- administration of MVA-NP+M1 with TIV results in increased T and B cell responses compared to TIV alone and should now be tested for improved efficacy in older adults who are in great need of an improved influenza vaccine. Since NP and M1 are highly conserved antigens, strain mismatch is not expected to reduce vaccine efficacy. The assessment of the breadth of the humoral responses to HA in each of the study groups is now underway, as the use of adjuvants or viral vectored delivery of HA has previously been shown to increase the breadth of antibody recognition of HA. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P125 POSTE R A BSTRAC TS SPA5P10 Evaluation of attenuate and reproductive properties of influenza A vaccine strain RA35 (H7N9) based on new donor strain A/ HongKong/1/68/162/35. Vidyaeva, Inna; Potapchuk, Marina; Petrov, Sergei; Sergeeva, Maria; Tsybalova, Liudmila Research Institute of Influenza, Ministry of Health of the Russian Federation, St. Petersburg, Russia, Russian Federation Background Obtained in NII Influenza virus strain A/HongKong/1/68/162/35 (H3N2) (A/HK/ca), combines both properties attenuate temperature – sensitive (ts) and cold-adapted (ca) and high growth in embryonated eggs (EE). Reassortants that contain surface protein genes from various wild influenza viruses (H1N1, H3N2, H5N1, H3N8) and internal protein genes from new vaccine donor strain A/HongKong/1/68/162/35 (H3N2) inherited main donor properties: high growth in chicken embryos, ts- and ca- phenotype, safety in laboratory animals. Methods To obtain a reassortant strain of influenza virus A/Shanghai/HK/6:2 (H7N9) (RA35) we used the A/HK/ca strain as a donor of internal protein genes. Surface antigens were derived from strain А/Shanghai/2/2013(H7N9) - PR8-IDCDCRG32A, that was kindly presented by CDC, Atlanta, USA. It was used method of classical reassortation in 10- days EE. Gene constellation was determined by RT-PCR-RFLP analysis. Sequences of HA and NA were studied by RT-PCR with subtype-specific primers. The degree of attenuation RA35 reassortant investigated by reproduction in EE at different temperatures. Results According to data, of restriction analysis of amplified in RT-PCR viral RNA fragments, reassortant virus strain A/Shanghai/HK/6:2 (H7N9) (RA35) had 6 genomic segments (PB2, PB1,PA, NP, M, NS) from donor A/ HongKong/1/68/162/35 (H3N2) and 2 (HA, NA) from virus PR8-IDCDC-RG32A strain of virus А/Shanghai/2/2013 (H7N9). It was shown that RA35 strain actively replicates in EE at 32°C, weakly at 26°C and does not replicate at 39°C. RCT26 was 3.66 lg, RCT32 – 9.5 lg, RCT39 – <0.5 lg. For parent strain A/Shanghai/2/2013(H7N9)-PR8-IDCDC-RG32A (H7N9) optimal reproduction temperature is 34-35°C (RCT34 – 6.5 lg). So replacement of internal protein genes of the donor strain A/PR8 genes donor A/HongKong/1/68/162/35 led to the emergence of signs of attenuation and ts ca. Moreover this reassortant had a higher reproductive activity. In hemagglutination inhibition test it was shown that RA35 had bound with specific rat immune sera of types A(H7N3) and A(H7N9) only. Аfter a series of 5 passages in chicken embryos the strain saves its infectious, heagglutinating and antigenic properties either. Conclusions Using new vaccine donor strain A/HongKong/1/68/162/35 (H3N2) we have obtained a reassortant strain with surface antigens from actual high pathogenic influenza virus A(H7N9). The reassortant RA35 (A/Shanghai/ HongKong/6:2 (H7N9) had ca, ts phenotype and high-growth in embryonated eggs. The obtained RA35 strain has all properties reguired for development as live as inactivated influenza vaccines. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P126 POSTE R A BSTRAC TS SPA5P11 Development, pre-clinical and clinical evaluation of potentially pandemic H2N2 live attenuated influenza vaccine Isakova-Sivak, Irina (1); de Jonge, Jorgen (2); Smolonogina, Tatiana (1); Rekstin, Andrey (1); Kiseleva, Irina (1); Kuznetsova, Victoria (1); Donina, Svetlana (1); Petukhova, Galina (1); Naykhin, Anatoly (1); Pisareva, Maria (3); Stukova, Marina (3); Erofeeva, Mariana (3); Tsvetnitsky, Vadim (4); Flores, Jorge (4); Rudenko, Larisa (1) 1: Institute of Experimental Medicine RAMS, Saint Petersburg Russian Federation; 2: Centre for Infectious Disease Control, RIVM, Bilthoven, the Netherlands; 3: Institute of Influenza, Saint Petersburg Russian Federation; 4: PATH Vaccine Development Global Program, Seattle, Washington, USA Introduction H2N2 influenza viruses disappeared from circulation among humans in 1968 but continue to circulate in wild birds causing potential pandemic threat. Live attenuated influenza vaccines (LAIV) prepared from avian influenza viruses are usually poorly immunogenic in humans. Therefore we used human H2N2 wild-type viruses to prepare two LAIV candidates using a well characterized A/Leningrad/134/17/57 (Len/17) master donor virus (MDV) as the backbone. Methods Two H2N2 LAIV candidates were prepared by classical reassortment of wild-type viruses A/Tokyo/3/67 and A/ California/1/66 with an intermediate reassortant virus carrying internal genes of Len/17 MDV and surface genes of A/New Caledonia/10/99 (H1N1). These candidates were tested in mice and ferrets for attenuation, immunogenicity and protective efficacy against homologous and heterologous H2N2 challenge. Pre-clinical evaluation also included assessment of ts/ca phenotypes, genetic stability, antigenicity and toxicity. A/17/California/66/395 LAIV candidate was studied in phase I clinical trial. 38 healthy adults aged 18 to 49 were randomized at 3:1 ratio to receive two doses of H2N2 vaccine or placebo with 28 days interval. Nasal and throat swabs were collected prior vaccination and at days 1 to 6 after first and second immunizations and tested for virus replication and genetic stability. Nasal swabs and saliva were collected at days 0, 28 and 56 for the assessment of local immune responses. Blood samples were collected at days 0, 6, 28, 56 and 112 after first vaccination. Antibody immune responses were assessed by HAI and microneutralization assays (serum) and by ELISA (IgG, IgA in serum, nasal swabs and saliva). Cellular immune responses were evaluated by the presence of virus-specific CD4+IFNγ+ and CD8+IFNγ+ PBMCs using flow cytometry cytokine assay. Results Both H2N2 LAIV candidates had phenotypical characteristics comparable with Len/17 MDV. Pre-clinical studies demonstrated safety, genetic stability, immunogenicity, cross-reactivity and protective efficacy of both H2N2 strains. A/California/1/66-based reassortant was more immunogenic and better protective against homologous and heterologous challenge in ferrets than A/Tokyo/3/67- based candidate. Therefore A/17/California/66/395 was selected for further clinical trials. A/17/California/66/395 was safe and well-tolerated for healthy adults. 11 of 28 and 19 of 28 volunteers shed the virus after first dose (and 8 of 27 and 20 of 27 after second dose) when tested by culturing in eggs or qRT-PCR, respectively. Vaccine virus isolates were genetically stable and no mutations were detected in HA and NA genes. 85.2% volunteers had systemic and/or local antibody immune responses if measured by any assay. Nearly 30% of the volunteers had significant increases in levels of CD4+ and/or CD8+ virus-specific IFNγ-secreting cells. Total 88.9% of volunteers had any immune response after one or two doses of H2N2 LAIV. Conclusions A/17/California/66/395 H2N2 LAIV candidate was attenuated, immunogenic and effective in pre-clinical trials and proved to be safe and immunogenic in phase I clinical trial. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P127 POSTE R A BSTRAC TS SPA5P12 Cross-reactive antibodies and specific CD8 T-cells induced by conserved consensus HA2 of influenza viruses A/H2N2 delivered with flagellin Stepanova, Liudmila; Potapchuk, Marina; Kuznetsov, Vasiliy; Sergeeva, Maria; Kovaleva, Anna; Korotkov, Alexandr; Tsybalova, Liudmila Research Institute of Influenza, St. Petersburg, Russia, Russian Federation Background Isolation of cross-reactive monoclonal antibodies specific to conservative epitopes of the second subunit of influenza virus hemagglutinin (HA2) suggest, that HA2 stem region may be a promising candidate for development of broadspectrum influenza vaccine. Anti-HA2 antibodies can prevent viral fusion step, inhibit viral replication and provide protection of immunized mice from lethal influenza challenge. Considering that T-cell immunity also plays an important role in clearance of the virus and decreases the severity of infection. We designed HA2-epitope vaccine on the basis of flagellin, known to enhance T- and B-cell immune response. The aim of this investigation was to study the capacity of recombinant protein comprising consensus fragment HA2(35-107) of influenza A/H2N2 viruses linked to flagellin to induce cross-reactive antibodies and specific CD8+ T-cells. Methods We constructed a recombinant fusion protein FLG-HA2 containing consensus sequence of HA2(35-107) of influenza A/H2N2 viruses linked to the C-terminus of full-length flagellin. The corresponding sequence was synthesized and cloned in pQE30 vector. FLG-HA2 protein was expressed in E.coli, purified by chromatography and used to immunize Balb/c(H-2b) and C57BL/6(H-2d) mice. Three intranasal immunizations with 50 μg of FLG-HA2 were done in 2-week intervals, control mice received PBS. To estimate the cross-reactivity of induced anti-HA2 IgG antibodies we performed ELISA with purified influenza A viruses: A/Singapore/1/57(H2N2), A/PR/8/34(H1N1), A/Aichi/1/68(H3N2) and A/Kurgan/5/05 RG(H5N1) and with synthetic linear peptides corresponding to HA2 regions 35-58(AADKESTQKAFDGITNKVNSVIEK), 59- 73(MNTQFEAVGKEFSNL) and 74107(ERRLENLNKKMEDGFLDVWTYNAELLVLMENERT). Intracellular cytokine staining of IFN-γ was used to study antigen stimulated CD8+ T-cell activation in splenocytes of mice 10-30 days post immunization. Immunized mice were challenged with 1LD50 of A/Singapore/1/57(H2N2) and monitored daily for survival and weight loss. Results Anti-HA2 antibodies (IgG in serum and IgG, sIgA in BAL) generated after immunization with FLG-HA2 reacted with mentioned above synthetic peptides and most strongly with 74-107 peptide. Induced antibodies recognized HA2 of whole influenza A/H2N2 virus as well as of other influenza A viruses from phylogenetic group 1 (H1N1 and H5N1). We detected significant production of intracellular IFN-γ (p<0.05 as compared with control group) by CD8+ T-cells in spleen of immunized Balb/c and C57BL/6 mice after stimulation by each of mentioned HA2 peptides and by whole virus. We also observed significant reduction in weight loss and increase in survival rate for immunized mice upon influenza A/H2N2 lethal challenge. Conclusions The data obtained shows that recombinant protein FLG-HA2 induce cross-reactive antibodies which can bind to phylogenetic group 1 influenza A viruses and most strongly to HA2 peptide 74-107, that contains YNAELLVLMEN sequence, shared by majority of experimental CD4+ and B-cell epitopes found in HA2. Furthermore FLG-HA2 induce specific CD8+ T-cells. Thus immunization with FLG-HA2 can provide complete and cross-reactive immune response against influenza. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P128 POSTE R A BSTRAC TS SPA5P13 Adjuvation broadens the protective efficacy of a seasonal influenza vaccine in mice Cox, Freek; Saeland, Eirikur; Baart, Matthijs; Koldijk, Martin; Goudsmit, Jaap; Radosevic, Katarina Crucell Vaccine Institute, Janssen Center of Excellence for Immunoprophylaxis, The Netherlands Background It remains a high priority to establish universal immunity to influenza by vaccination. Licensed seasonal influenza vaccines induce strain-specific immunity and must be updated annually based on predicted strains that will circulate in the upcoming season. Viral Hemagglutinin (HA) and Neuraminidase (NA) contribute to strain variability, but these antigens also contain conserved epitopes that may be targeted by vaccination. In the current study, we aim to broaden the protective efficacy of a seasonal influenza vaccine, in particular a Trivalent Virosomal Vaccine (TVV, containing H1N1, H3N2 and B strains of the 2010/2011 season), by adjuvation with a saponin-based adjuvant (Matrix-M). Methods Balb/c mice were immunized with TVV with or without Matrix-M three weeks apart. Four weeks after the final immunization, mice were challenged with heterologous and avian influenza strains. Challenged mice were monitored for survival, weight loss and clinical signs for 21 days. A separate experiment was performed where HAspecific antibody titers and Hemagglutination inhibition (HAI) titers were measured in serum samples of immunized mice and IFN- producing T cells were measured by ELISPOT. Results Mice immunized with Matrix-M adjuvated TVV showed significant survival after challenge with heterologous and avian influenza strains compared to the vehicle control whereas mice immunized with TVV alone did not. Furthermore, TVV+Matrix-M immunized mice showed reduced body weight loss and clinical scores compared to the vehicle control. Matrix-M enhanced both antibody and T cell responses induced by TVV against the influenza strains used for challenge. Conclusions Our results demonstrate that adjuvation may effectively broaden the protective efficacy of a virosomal seasonal influenza vaccine. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P129 POSTE R A BSTRAC TS SPA5P14 Universal influenza vaccine development based on the MVA vector platform Altenburg, Arwen F.; Kreijtz, Joost H.C.M.; de Vries, Rory D.; De Gruyter, Heidi L.M.; Osterhaus, Albert D.M.E.; Rimmelzwaan, Guus F. Erasmus MC, The Netherlands Due to the antigenic drift of influenza viruses, current influenza vaccines need to be updated annually. These seasonal influenza vaccines are based on the prediction of which strains will most likely circulate next season. However, if the circulating strains do not match the strains used in the vaccine, the efficacy of the vaccine is greatly reduced. Furthermore, in the case of a pandemic outbreak vaccines prepared with the matching virus strain often becomes available too late. This illustrates the need for the development of a universal influenza vaccine that induces long lasting and broadly protective immunity. Ideally, universal influenza vaccines induce both cross- reactive antibody and T cell responses. In order to achieve this goal, we have made various modifications to conserved influenza virus proteins to improve antigen processing and presentation to virus specific T cells. To improve cross-reactive antibody responses to the hemagglutinin also this protein was modified to redirect the antibody response from the globular head region to the more conserved stalk region. The modified antigens are expressed and presented to the host’s immune system using the replication deficient Modified Vaccinia virus Ankara (MVA). MVA has proven to be a safe method for antigen delivery and has been shown to be able to induce both T-cell as well as B-cell responses. The various vaccine candidates are characterized in vitro to assess if the modifications have the desired effect. Next, the vaccine candidates are tested for their potential to induce protective immunity against a lethal challenge with homologous/heterologous influenza viruses in mice. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P130 POSTE R A BSTRAC TS SPA5P15 Influence of different schedules of chicken immunization with DNA vaccine against avian influenza H5N1 virus on antibody response Góra-Sochacka, Anna; Stachyra, Anna; Sirko, Agnieszka Institute of Biochemistry and Biophysics, Polish Academy of Sciences, Poland Background H5N1 virus is the causative agent of highly pathogenic avian influenza which leads to severe economic losses in poultry industry. For the prevention and control of influenza infections vaccination is preferred strategy. Our study is focused on DNA vaccine which is consider as safety, new generation vaccine consistent with DIVA strategy. We engineered DNA vaccine for chickens against avian H5N1 influenza virus and analyzed humoral response after its application. Different immunization schedules enabled us to compare dynamics of chicken humoral response depending on the number of doses (one or two) and on the booster time (two or three weeks after the priming). Methods Mixure of plasmid carrying cDNA encoding hemagglutinin (HA) from H5N1 A/swan/Poland/305-135V08/2006 (EpiFluDatabase [http://platform.gisaid.org]; Accession No. EPI156789) with Lipofectin was used as a vaccine. Broiler (Ross 308) chickens were immunized with DNA vaccine intramuscularly according to the following schemes: (Scheme 1) immunization on day 7, (Scheme 2) immunization on days 7 and 21, (Scheme 3) immunization on days 7 and 35. The control group was immunized with mixture of the empty vector with Lipofectin. Regardless of the scheme, the blood samples were collected four times: (i) two weeks after the first vaccination, (ii) on the day of a booster, (iii) one week and (iv) two weeks after the booster. Indirect ELISA was performed for detection of anti-HA IgY antibodies in blood samples. Results The level of anti-HA antibodies in serum samples of chickens immunized only once with DNA vaccine was marginally higher than in control chickens (immunized with empty vector), and was shown as statistically insignificant. The meaningful rise of specific antibodies was observed one week after the second (booster) immunization regardless of the schedules. The significant level of antibodies was observed till the end of experiment (49th day of chickens life). Conclusions Comparison of three different immunization schedules indicated the need of booster dose of vaccine to achieve efficient humoral response protecting chickens against influenza virus. Acknowledgments: This work was supported by Innovative Economy Program, Grant No. WND POIG.01.01.02-00007/08. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P131 POSTE R A BSTRAC TS SPA5P16 A universal influenza virus vaccine strategy based on the conserved stalk domain of the hemagglutinin Krammer, Florian (1); Margine, Irina (1,2); Nachbagauer, Raffael (1); Pica, Natalie (1,2); Hai, Rong (1); Albrecht, Randy A. (1,4); García-Sastre, Adolfo (1,3,4); Palese, Peter (1,3) 1: Department of Microbiology, Icahn School of Medicine at Mount Sinai, New York, New York, USA; 2: Graduate School of Biological Sciences, Icahn School of Medicine at Mount Sinai, New York, New York, USA; 3: Department of Medicine, Icahn School of Medicine at Mount Sinai, New York, New York, USA; 4: Global Health & Emerging Pathogens Institute, Icahn School of Medicine at Mount Sinai, New York, New York, USA Background Influenza virus infections remain a significant cause of morbidity and mortality worldwide. Current vaccines show good efficacy against antigenically matched viruses by inducing strain specific antibodies against the membranedistal globular head domain of the viral hemagglutinin, but fail to protect against drifted and pandemic strains. Due to the rapid antigenic drift of influenza viruses - especially in the globular head domain - these vaccines have to be re- formulated, generated and administered through a cumbersome and expensive process every year. The membrane-proximal stalk domain of the viral hemagglutinin exhibits a high degree of both sequence and structural conservation across influenza virus subtypes and monoclonal antibodies directed against this region typically show broad neutralizing activity. However, these antibodies are rare and usually not induced/boosted by regular seasonal vaccines. We hypothesize that a vaccine strategy that stimulates a robust immune response towards this region of the hemagglutinin could provide universal influenza virus protection. Methods We developed a universal influenza virus vaccine based on the conserved stalk domain of group 1 and group 2 hemagglutinins. By sequential vaccination of mice with chimeric hemagglutinin constructs that share the same stalk domain but have divergent head domains we were able to specifically boost broadly neutralizing antibody titers against conserved epitopes in the hemagglutinin stalk. Results Mice vaccinated with our constructs were protected from morbidity and mortality induced by infection with a panel of heterologous and heterosubtypic influenza A viruses. In the light of emerging viruses in Asia it is of note that our vaccination regimen also protected animals from H6N1 and H7N9 virus challenges and reduced lung titers upon H10 virus infection. In addition the chimeric HA based vaccination regimen also showed efficacy in ferrets, induced high titers of broadly reactive antibodies against divergent hemagglutinins from different subtypes and significantly reduced transmission in this model. Finally, we showed that stalk-reactive antibodies were boosted in individuals that received an H5N1 vaccine in clinical trials. This supports the hypothesis that exposure to hemagglutinins with divergent heads but conserved stalk induces such antibodies in humans. Conclusions The present data suggest that this vaccine strategy could be successfully developed in humans to provide broad influenza virus protection and enhance our pandemic preparedness. A universal influenza virus vaccine, which similar to the ones developed for polio and measles viruses - requires a single or only a few immunizations, would represent a major advance towards the control of influenza worldwide. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P132 POSTE R A BSTRAC TS SPA5P17 Cost-effectiveness of quadrivalent versus trivalent influenza vaccine in Germany: a Markov multi-cohort model Poulsen Nautrup, Barbara (1); Meier, Geneviève (2); Anastassopoulou, Anastassia (3); Welte, Robert (3); Gregg, Meghann (2) 1: EAH-Consulting, Aachen, Germany; 2: GlaxoSmithKline Vaccines, Wavre, Belgium; 3: GlaxoSmithKline GmbH & Co. KG, München, Germany Background Co-circulation of influenza B lineages and mismatch in influenza vaccines can cause increased burden of disease in a population. To minimize this burden a quadrivalent inactivated influenza vaccine (QIV) has been developed including virus strains of two A sub-types and of both B lineages. This analysis estimates the cost-effectiveness of adopting a quadrivalent vaccine versus the current trivalent vaccine (TIV) in Germany. Methods A Markov model was used to estimate cost-effectiveness. Cycle length was one year with a life- time horizon (100 years). A payer and societal perspective were taken and the vaccinated population is the entire German population (considering reported vaccination coverage rates). Cost of QIV was €12.32, TIV €10.21 (average of TIV vaccines in Germany). A meta-analysis was used to inform vaccine efficacy. Other input data was sourced via a targeted literature review from peer-reviewed and government publications. Costs and effects were discounted at 3%. Sensitivity analysis was conducted (univariate, scenario, and probabilistic). Published suggestions for incorporation of indirect effects into static models were used for the approximation of the impact of a herd effect associated with the vaccination of children in scenarios. Results The Incremental Costs Effectiveness Ratio (ICER) was €25,921 (payer perspective) and €17,628 (societal perspective). It is estimated that in an average influenza season vaccinating with QIV instead of TIV averts 52,105 cases, 15,462 first line medical advice visits, 6,063 influenza complications, 1,408 hospitalisations, and 119 deaths. The most sensitive model parameters were circulation of influenza A and matching of B lineage to trivalent vaccine. At a €50,000 threshold, probabilistic sensitivity analysis estimates 85% of simulations to be cost- effective (payer), and 90% (societal). Scenarios considering universal mass vaccination (at a coverage rate of 75%) of all individuals <18 years yield an ICER of €25,571 (payer) and €13,044 (societal) without consideration of a herd effect. When considering a generic or influenza-based herd effect, ICERs decrease to €23,563 or €17,704 (payer) and €10,651 or €3,186 (societal), respectively. Conclusions Given a €50,000/quality adjusted life year (QALY) gained threshold the quadrivalent vaccine could be considered cost-effective. Vaccine mismatch due to influenza B and co-circulation of B lineages has occurred in Germany in six out of ten seasons (2000-2010). It is estimated that a quadrivalent vaccine would reduce the burden of influenza in mismatch and co-circulation years. The estimated reduction being more prominent considering a herd effect associated with vaccinating children. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P133 POSTE R A BSTRAC TS SPA5P18 Evaluation of the campaign’s impacts of influenza vaccination in the productivity of workers of brazilians industries Mattos, Bianca Ramos de Freitas (1); Araujo, Gabriela Tannus Branco (2); Fonseca, Marcelo Cunio Machado (2); Sansone, Dayan (2); Homsani, Sheila (3); Bricks, Lucia Ferro (3); Liao, Paulo Sti Lin (3); Guarino, Hubert (3) 1: SESI - Social Service of Industry, Brazil; 2: Axia.Bio Consulting; 3: Sanofi Pasteur Background Flu is still a big cause of absenteeism and presenteeism in Brazil. SESI (Social Service of Industry) is a private Nationwide organization, supported by brazilian industries, acting since 1946, with the objective of promoting better education and workplace safety and health. In 2013, SESI had a National Campaign against Flu, on all of 27 brazilian States with the objective of evaluate the economic and social impacts of flu vaccination and the return of investment for brazilian Industries. Methods SESI provided flu vaccine to more than 900.000 workers distributed in 5.100 industries Nationwide, however, only 662.763 workers provide complete data to traceability. The cost-benefit analysis was made and validated through mathematic model (Vaxincorp®), allowing the evaluation of the cost’s investiment on the vaccination campaign and consequent absenteeism and presenteeism reduction. Some industries also provided economics internal data for analysis. The sample used was 85 industries, 13 provided complete data, and 72 large industries used data from research published in the Brazilian Magazine Exame – bigest and best of 2012, such as, operating profit, salary, missing work among others. Results Data from Vaxincorp®, added with data from participating companies demosntrated that influenza vaccination avoided 63.000 flu cases and 136.080 days of lost productivity, wich 22.680 days off per medical license and 113.400 presenteeism days. The total return of investiment was EUR 35,31 for vaccinated worker, which allows a prospective analysis of EUR 23.426.932,80 for bazilian industries that participated on SESI’s campaign. Conclusions Based on theses results, Influenza Vaccination in companies is an action of health that generates a positive costbenefit analysis and should be considered annually, regardless of company size. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P134 POSTE R A BSTRAC TS SPA5P19 Cross-protection by human and avian M2e-displaying virus-like particles Christopoulou, Ioanna (1,2); Schotsaert, Michael (1,2); Roose, Kenny (1,2); Fiers, Walter (1,2); Saelens, Xavier (1,2) 1: VIB Inflammation Research Center, Technologiepark 927, Ghent, Belgium; 2: Department for Biomedical Molecular Biology, Ghent University, Technologiepark 927, Ghent, Belgium Background Influenza is a global burden. The vaccines currently in use protect through the induction of neutralizing antibodies against haemagglutinin (HA) and neuraminidase (NA) but need almost yearly update due to significant antigenic variation (antigenic drift). In our lab we have developed a universal influenza A vaccine based on the extracellular domain of matrix protein 2 (M2e) which is highly conserved. Here we assessed the potential cross-protection, using a mouse model, of immunization with human(h) or avian(a) derived M2e against heterologous challenge. Methods Female BALB/c mice (SFP, 6-8 weeks old) were immunized twice intraperitoneally with either hM2e-VLP, aM2e-VLP, or VLP alone. After the second immunization, 0,5LD50 of mouse-adapted X47 (H3N2) or A/Mallard/Alberta/676/79 (H3N6) viruses was administered intranasally to these mice. Mice were monitored for 14 days post challenge for mortality/morbidity. Virus titers were measured in the lungs, T cell responses were analyzed by flow cytometry and IFNγ producing cells were measured by ELISPOT. Results In a BALB /c mouse model, vaccination with hM2e-VLP or aM2e-VLP resulted in the induction of M2e specific serum IgG antibody titers, strongly reduced morbidity and conveyed full protection after a A/Mallard/Alberta/676/79 (H3N6) or X47 (H3N2) challenge. We show that immunization reduced virus replication in the lungs, with the hM2e-VLP being more effective in controlling virus replication than aM2e-VLP. IFNγ producing cells were also highly induced with a 20-fold increase in the hM2e-VLP immunized group compared to control. Interestingly mice immunized with hM2e-VLP had better IFNγ response when challenged with the avian like virus H3N6 compared to aM2e-VLP immunized mice that had been challenged with the same virus. Finally, T cell response analysis showed that TNFα and IFNγ production is augmented in both vaccinated groups. Conclusions We showed that vaccination with human or avian derived M2e-VLP universal vaccine protects against challenge with viruses of different origin, as mice immunized with hM2e were equally protected against human and avian origin influenza A viruses, whereas mice immunized with aM2e were also protected against avian influenza virus and to some extend against human influenza A virus. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P135 POSTE R A BSTRAC TS SPA5P20 Mice immunization against influenza with three variants of DNA vaccine encoding hemagglutinin.from H5N1. Redkiewicz, Patrycja (1); Góra-Sochacka, Anna (1); Kosson, Piotr (2); Sirko, Agnieszka (1) 1: Institute of Biochemistry and Biophysics, PAS, Poland; 2: Mossakowski Medical Research Center PAS, Poland Background Our study was focused on the improvement of hemagglutinin (HA from H5N1) antigen expression in mammalian cells in order to enhance its immunogenic potential as a DNA vaccine against influenza virus. For these purposes three variants of the plasmids containing modified nucleotide sequence of HA were prepared and their immunogenic potential was tested in mice. Methods 4-6 weeks old BALB/c mice were immunized two times intramuscularly in the quadriceps muscle at two weeks intervals with either 50 μg or 10 μg of plasmid DNA complexed with the lipid carrier (lipofectin). Two weeks after the prime dose, one week after the boost dose and two weeks after the boost dose the blood samples were collected and sera were prepared. Mice were scarified and spleens were isolated four weeks after the first dose. HA-specific IgG titers in sera samples were determined by indirect ELISA. The proliferation ability of murine splenocytes stimulated with commercial hemagglutinin H5 from A/Bar-headed Goose/Qinghai/12/05 H5N1 strain was determined using CellTiter 96® AQueous One Solution Cell Proliferation Assay (MTS). Results/ Conclusion Both vaccine doses (50 μg and 10 μg) of all three tested plasmids elicited HA-specific IgG antibody response. However, the level of the response depended on the variant and the dose. Additionally, the preliminary study of splenocytes proliferation confirmed that the tested vaccines elicited the T-cell proliferative responses. Acknowledgments: This work was supported by Innovative Economy Program, Grant No. WND- POIG.01.01.02-00007/08. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P136 POSTE R A BSTRAC TS SPA5P21 Assessment of the public health benefit of quadrivalent influenza vaccine in the United Kingdom from 1996–97 to 2008–09 seasons Matias, Goncalo (1); Taylor, Robert J. (2); Haguinet, Francois (1); Kim, WonGyu Lewis (2); Lustig, Roger (2); Fleming, Douglas M. (3) 1: GlaxoSmithKline Vaccines, Wavre, Belgium; 2: Sage Analytica, Bethesda, MD, USA; 3: Independent Consultant, Birmingham, UK Background Influenza B burden might be reduced by the use of quadrivalent influenza vaccines (QIV, containing both circulating B lineages, Yamagata and Victoria) instead of the current trivalent influenza vaccines (TIV, containing only one B lineage). This study (ClinicalTrials.gov: NCT01520935) assessed the potential of QIV to reduce influenza B-attributable events by preventing influenza B lineage mismatch in the United Kingdom (UK). Methods The hypothetical decrease in influenza B burden was estimated through a simple multiplier model based on Reed’s probability model (Reed et al, Vaccine 2012). That model acted on seasonal burden estimates obtained by applying Background: Influenza B burden might be reduced by the use of quadrivalent influenza virus-guided regression models to time series ofcontaining general both practice (GP)B visits, hospitalizations and instead deathsoffor vaccines (QIV, circulating lineages, Yamagata and Victoria) the a current trivalent influenza (TIV, Practice containing Research only one Database B lineage). (GPRD), This study respiratory disease broadly defined outcome extracted fromvaccines the General the (ClinicalTrials.gov: NCT01520935) assessed the potential of QIV to reduce influenza BHospital Episode Statistics (HES) database andevents the Office of National (ONS) in mortality For GP attributable by preventing influenza Statistics B lineage mismatch the United database. Kingdom (UK). visits, the outcome definition included all respiratory diagnoses, respiratory symptoms, viral infections not otherwise Methods: The hypothetical decrease in influenza B burden was estimated through a simple specified (NOS) and otitis media; for hospitalizations andondeaths, the definition respiratory diagnoses, multiplier model based Reed’s probability model included (Reed et al,all Vaccine 2012). That model acted on seasonal burden estimates obtained by applying virus-guided regression models to viral infections NOS and septicemia (any mention). Summer weeks were excluded model. time series of general practice (GP) 23–35 visits, hospitalizations and from deathsthe for aregression respiratory disease broadly defined Boutcome extracted from the General Practice Research Database the The study used seasonal proportions of influenza from Public Health England, vaccine coverage data (GPRD), from GPRD Hospital Episode Statistics (HES) database and the Office of National Statistics (ONS) mortality and the vaccine effectiveness values used by Reed et al (47% matched andincluded 0% forall mismatched seasons). database. For GP visits, thefor outcome definition respiratory diagnoses, respiratory Results symptoms, viral infections not otherwise specified (NOS) and otitis media; for hospitalizations and deaths, the definition included all respiratory diagnoses, viral infections NOS and septicemia (any mention). Summer weeks 23–35 were excluded from the regression model. The study used seasonal proportions of influenza B from Public Health England, vaccine studied seasons were B-mismatched, B and proportions of 1%–67%; there was one etB-dominant coverage data fromwith GPRD the vaccine effectiveness values used by Reed al (47% for matched and 0% for mismatched seasons). season (2005–06). In an average season, 8,333 GP visits, 139 hospitalizations and 35 deaths were 6 of the 13 mismatched estimated as preventable by QIV versus TIV (table). The percentages of preventable GP B visits, hospitalizations and Results: 6 of the 13 studied seasons were B-mismatched, with proportions of 1%–67%; there was one B-dominant mismatched season (2005–06). In an average season, 8,333 GP visits, deaths by QIV versus TIV among all influenza B-attributable corresponding events were highest in ≥65-year-olds, 139 hospitalizations and 35 deaths were estimated as preventable by QIV versus TIV (table). The percentages of preventable GP visits, hospitalizations and deaths by QIV versus TIV during 2005–06 (36% each). Conclusions among all influenza B-attributable corresponding events were highest in ≥65-year-olds, during 2005–06 (36% each). Conclusions: The potential benefit of QIV depends on influenza B circulation, degree of The potential benefit of QIV dependsvaccine on influenza circulation, degree of on vaccine and vaccine coverage. match andBvaccine coverage. However, average,match under reasonable assumptions of vaccine effectiveness, substantial numbers of influenza-related GP visits, hospitalizations and However, on average, under reasonable assumptions of vaccine effectiveness, substantial numbers of influenzadeaths were estimated to be possibly QIV-preventable during the study period in the UK. related GP visits, hospitalizations and deaths were estimated to be possibly QIV-preventable during the study period Funding: GlaxoSmithKline Biologicals SA in the UK. Funding GlaxoSmithKline Biologicals SA TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P137 POSTE R A BSTRAC TS SPA5P22 Evaluation of immunogenicity and cross-protective efficacy of MVAtor™based universal influenza vaccine candidates in mice against H1N1, H5N1 and H7N9 influenza strains Auer, Sebastian; Wachs, Frank-Peter; Leyrer, Sonja Emergent Biosolutions - Emergent Product Development Germany GmbH Background The current vaccination strategy against influenza virus consists of a live- attenuated or killed virus vaccine regimen containing two influenza A subtypes and one or two B subtypes which are predicted to be most prevalent in the upcoming influenza season. This approach requires adaptation of the vaccine every year and protective efficacy can vary due to mismatches caused by strain mutation and evolution. Thus, there is a high demand for the development of a universal vaccine that provides protection against all types of influenza viruses, including emergent pandemic strains. This requires the identification and utilization of conserved regions in influenza proteins which show no or only low antigenic variability by strain or over time, and directing the immune system to develop antibodies against these conserved portions. Emergent BioSolution has developed several MVAtorTM (modified vaccinia virus Ankara vector) based vaccine candidates expressing conserved influenza A antigens. The tested antigens include nucleoprotein (NP), a combination of six different external domains of matrix protein 2 (M2) designated multi-epitope tandem repeat (METR) and variants of hemagglutinin (HA). Methods Recombinant MVAtor vaccine candidates were generated by insertion of influenza virus conserved antigens NP, METR and HA in the MVA DelIII insertion site by homologous recombination. Vaccine candidates were plaque purified and stocks were generated on chicken embryo fibroblast (CEF) cells or on the duck cell line AGE1.CR.pIX. Expression of influenza antigens was confirmed by Western Blot, Direct ELISA or RT-PCR, and genomic stability of recombinant MVAtor constructs was verified by sequential passaging on the production cell line and insert sequencing. For a murine challenge study, BALB/c mice were immunized intramuscularly twice with 1x108 TCID50/animal on days 1 and 22 with different combinations of vaccine candidates in homologous and heterologous prime/boost regimens or controls. Vaccinated mice were challenged on day 43 with H1N1 A/Puerto Rico/8/34 (5/50 LD50), H7N9 A/Anhui/1/2013 (5/50 LD50), and H5N1 A/Vietnam/1203/2004 (10/100 LD50). Immune response, survival, weight loss, and viral load in lungs were assessed. Results All generated recombinant MVAtor universal flu constructs were grown to high titer stocks and demonstrated good growth rates comparable to the parental MVAtor vector. In vitro analysis of the vaccine candidates by Western Blot, Direct ELISA or RT-PCR showed high expression levels of the antigens and the expected molecular weights for all constructs. In a genomic stability analysis after six sequential passages on the production cell line AGE1.CR.pIX all constructs showed full insert integrity and displayed no deletions or single nucleotide polymorphisms, indicating genomic stability for at least six passages. Preliminary murine immunogenicity and protective efficacy studies showed partial to full protection against various influenza strains. Confirmative murine in vivo efficacy studies are in progress. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P138 POSTE R A BSTRAC TS SPA5P23 Prime-boost DNA vaccination protects chickens against challenge with homologues and heterologues H5N1 virus Stachyra, Anna (1); Smietanka, Krzysztof (2); Minta, Zenon (2); Gora-Sochacka, Anna (1); Sirko, Agnieszka (1) 1: Institute of Biochemistry and Biophysics Polish Academy of Sciences, Poland; 2: National Veterinary Research Institute, Poland Background DNA vaccination is a promising strategy to control and prevent the influenza virus circulation among domestic birds. It fulfills a DIVA strategy and eliminates need for handling of highly pathogenic, zoonotic virus, it is relatively easy and fast to produce. Despite the fact that many efforts were put in development and improvement of the DNA vaccines immunogenicity only a few veterinary products have been registered to date and no human DNA vaccine is available. In our study we optimized the nucleotide sequence of the main influenza antigen (HA) to improve efficiency of translation and RNA stability. The DNA in our experimental vaccine was complexed with liposomal carrier to improve the uptake of the plasmid by the host cells. Methods DNA vaccine encoding hemagglutinin from the H5N1 strain A/swan/Poland/305-135V08/2006 of influenza virus was tested in near to field conditions on broiler chickens in prime-boost strategy in several combinations. The gene had a deletion of the region encoding amino acids located at the proteolitic cleavage site and the codons were optimized to chicken. The immunological potential of the vaccine was proved by ELISA and HI tests and the most promising vaccination schedule (two doses, two weeks apart) was selected. Subsequently, the protective activity of the HA-DNA vaccine was confirmed. Experimental infection of SPF chickens was conducted 3 or 8 weeks after the second dose of the vaccine, using homologues and heterologues highly pathogenic virus strains to test the cross protection. Besides serological tests, the level of viral RNA was determined by RT-PCR in swab samples. Results Challenge experiment turned up that 100% of vaccinated chickens were protected against H5N1 from the same clade, without any clinical symptoms, whereas 70% of vaccinated chickens were protected against H5N1 from distinct clade. Additionally, shedding of the virus was not detectable in the case of chickens challenge 3 weeks after the booster or it was significantly reduced in the case of the chickens challenged 8 weeks after the boost. Conclusions Our experimental DNA vaccine has high efficacy, ensure partial cross protection and also limits transmission of the HPAI virus to the control contact chickens. Acknowledgments: This work was supported by Innovative Economy Program, Grant No. WND- POIG.01.01.02-00007/08. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P139 POSTE R A BSTRAC TS SPA5P24 Characterization of T cell responses induced by Flu SAM®(NP) and SAM®(M1) vaccines Magini, Diletta (1,2); Buccato, Scilla (2); Mangiavacchi, Simona (2); Giovani, Cinzia (2); Tavarini, Simona (2); Maione, Domenico (2); Brito, Luis (3); Nuti, Sandra (2); Mason, Peter (3); Settembre, Ethan (3); Montomoli, Emanuele (1); Geall, Andrew (3); Brazzoli, Michela (2); Bertholet, Sylvie (2) 1: University of Siena, Italy; 2: Novartis Vaccines Srl, Siena; 3: Novartis Vaccines, Cambridge Background Vaccination remains the most cost-effective way to prevent and control Influenza outbreaks. However current flu vaccines, including the two main surface antigens (HA and NA), do not provide efficacious heterosubtypic immunity. Therefore, the development of a successful universal vaccination strategy is urgently needed. To achieve this goal, several strategies are being tested. One approach is based on the induction of a T cell based response versus internal, more conserved flu antigens, such as the Nucleoprotein (NP) and the Matrix protein 1 (M1). The aim of this study is to improve the current HANA-based vaccines by including non-viral delivery of self-amplifying mRNA encoding the NP and M1 antigens. Methods Self-amplifying RNA replicons expressing the NP and M1 antigens of the Influenza virus A/PR/8/34 H1N1 were produced and tested for efficiency of self-amplification and antigen expression by flow cytometry. Immunogenicity of SAM®(NP) and SAM®(M1) vaccines were further evaluated by characterizing T cell responses to NP and M1 antigens by flow cytometry. Results We demonstrate that both SAM(NP) and SAM(M1) vaccines are immunogenic in Balb/c mice. SAM(NP) vaccine induced IFN-γ+ and LAMP-1+ NP-specific CD8+ T cells as well as multifunctional NP-specific CD4+ T cells. Furthermore, we observed the development of NP-specific IFNγ+/TNFα+ Effector and Central Memory CD8+ T cells, in addition to IL2+/TNFα+ memory CD4+ T cells. On the other hand, SAM(M1) vaccine induced a robust CD4 T cell-based response, including Ag- specific multifunctional Effector and Central memory CD4+ T cells, but no CD8 T cells in Balb/c mice. Experiments are currently ongoing to characterize how SAM(NP) and SAM(M1) vaccines may modify the phenotype and intensity of the immune response induced by a HA protein-based vaccine. Furthermore, we are assessing the possible contribution to protection of the individual and combined replicons to a HANA based vaccine. Conclusions SAM(NP) and SAM(M1) vaccines are immunogenic and induce T-cell immune responses that represent potent mediator of heterosubtypic immunity, therefore they are promising antigens in the designing a cross-protective flu vaccine. Since the SAM® vaccine technology offers several advantages compared to DNA or viral vector-based vaccines, it may be useful in the development of universal flu vaccine candidates. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P140 POSTE R A BSTRAC TS SPA5P25 Timerized Hemagglutinin Stalk Domain Based Vaccine Protect against Canine Influenza Virus Yeom, Minjoo (1,2); Na, Woonsung (1,2); Hong, Minki (1,2); Kim, Doo-Jin (1); Jung, Dae-Gwin (1,2); Kim, Jung-Ki (3); Kim, Sang-Hyun (1); Song, Daesub (1,2) 1: Korea Research Institute of Bioscience and Biotechnology, Korea, Republic of (South Korea); 2: University of Science and Technology; 3: Korea University Sejong campus Background The avian origin canine influenza virus H3N2 was reported in South Korea in 2007. Canine influenza H3N2 virus has continually circulated in dogs’ population. During recent canine influenza surveillance, a novel H3N1 canine influenza virus (CIV) that is a putative reassortant between pandemic H1N1 2009 and H3N2 CIVs was isolated. Highly Effective whole virus killed vaccine is being commercialized. However Killed vaccine has limited protection against heterologous viruses. To broaden the protective range against newly emerged reassortant viruses, highly conserved region of influenza antigenic protein might be important for developing broad-spectrum influenza vaccines. Recently, hemagglutinin stalk protein (HA2), stem region of influenza HA protein has gained increasing attention, because of the conserved stalk based antibodies are able to broadly protect against wide spectrum of influenza virus subtypes. Here, we successfully expressed partial hemagglutinin stalk proteins from PR8 H1N1 influenza virus. To increase immunogenicity, trimerized stalk domain protein was used for vaccine antigen. In this study, the immunogenicity and efficacy of trimerized stalk domain (3xHA95) based vaccine were evaluated. Also the synergistic effect after adding of 3xHA95 with canine influenza H3N2 vaccine was evaluated after virulent challenge with canine H3N2 and pandemic H1N1 viruses. The aim of this study is to improve the current HANA-based vaccines by including non-viral delivery of self-amplifying mRNA encoding the NP and M1 antigens. Methods To evaluate vaccine efficacy, guinea pigs were randomly assigned to each groups. Each groups immunize twice with vaccines contain inactivated whole virus, monomeric hemagglutinin stalk protein (mHA95), trimerized hemagglutinin stalk protein(3xHA95) and trimerized hemagglutinin stalk protein added inactivated whole virus. 2 weeks after last immunization, challenge with canine H3N2 and pandemic H1N1 viruses. Blood samples were collected at 0, 14, and 28 days after first immunization and nasal swab samples for the detection of viral shedding were also collected daily for 8 days post-inoculation (DPI) Results The guinea-pigs with the purified stalk domain based vaccine injections intramuscularly 2 weeks apart successfully produced stalk-specific antibodies. Serological investigation by an ELISA assay indicated that a significant increase in antibody titer was displayed 2 weeks after the second vaccination. Especially 3xHA95 antibody titer was significantly higher than that of HA95 monomer. Also we found that vaccinated guinea-pigs showed low viral shedding titers and shorter shedding duration with lower loads than non-vaccinated controls’. Conclusions We successfully purified partial antigenic HA stalk domain protein from PR8 and conducted its vaccine efficacy study for influenza virus challenges in guinea-pigs. In vaccinated animals, protective vaccine efficacy was observed against canine H3N2 and pandemic H1N1 viruses. Our results are meaningful for further understanding of an applicable range of the purified HA stalk domain protein and development of broad-spectrum vaccines, and this evokes further studies in dogs which is co-infected with H3N2 CIV and H1N1 influenza virus. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P141 POSTE R A BSTRAC TS SPA5P26 Increased Hemagglutinin Yield of Influenza Vaccine Viruses by Incorporation of Homologous PB1 Gene Adam Johnson (1), Emily Winne (2), David Cureton (1), Callie Ridenour (1), Wanda Santana (2), Taejoong Kim (1), John R. Barr (2), Ruben O. Donis (1), Julie Villanueva (1), Tracie Williams (2), Li-Mei Chen (1) 1: Influenza Division, National Center for Immunization and Respiratory Diseases; 2: Division of Laboratory Sciences, National Center for Environmental Health, Centers for Disease Control and Prevention, Atlanta, GA, United States. Background Candidate viruses for production of inactivated influenza vaccines are traditionally generated by reassortment between an influenza virus providing the genes encoding the HA and NA surface proteins and A/Puerto Rico/8/1934 (PR8) virus as donor of the internal genes (6:2 genotype) imparting high growth in eggs. Recent studies noted that the HA yields of certain reassortant viruses with PB1 originating from the same virus as the HA and NA genes (5:3 genotype) were greater than those of classical 6:2 counterparts. In this study, we systematically evaluated the impact of a homologous PB1 on hemagglutinin (HA) yields from diverse subtypes of viruses purified in sucrose gradients. Methods A panel of eight virus pairs with PB1 genes from PR8 or the surface gene donor viruses was generated by reverse genetics and purified by sucrose density gradient ultracentrifugation. Virus HA yields were quantified by isotope dilution mass spectrometry (IDMS) and SDS-PAGE/densitometry analysis. Results Infectious titers from virus pairs were similar regardless of their PB1 source. In contrast, the total virus protein and HA antigen yields from 4 of the 8 virus pairs increased by ~2-fold. Conclusions Our results suggest that increased HA antigen yields from eggs may be achieved for a subset of viruses by inclusion of a homologous PB1 during reassortment. This finding may be important for improvement of seasonal vaccine production and, most importantly, for rapid response to an emerging pandemic. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P142 POSTE R A BSTRAC TS SPA5P27 Development of influenza A(H7N9) candidate vaccine viruses with improved hemagglutinin antigen yield in eggs Callie Ridenour (1), Adam Johnson (1), Emily Winne (2), Jaber Hossain (1), Guaniri Mateu-Petit (1), Amanda Balish (1), Wanda Santana (2), Taejoong Kim (1), Todd Davis (1), John R. Barr (2), Ruben O. Donis (1), Julie Villanueva (1), Tracie Williams (2), Li-Mei Chen (1) 1: Influenza Division, National Center for Immunization and Respiratory Diseases; 2: Division of Laboratory Sciences, National Center for Environmental Health, Centers for Disease Control and Prevention, Atlanta, GA, United States. Background The emergence of avian influenza A (H7N9) virus in poultry causing zoonotic human infections was reported on April 1, 2013. Development of A(H7N9) candidate vaccine viruses (CVV) for pandemic preparedness purposes was initiated as soon as multiple additional human cases were reported by Chinese public health authorities. Although candidate vaccine viruses were quickly derived by reverse genetics with the internal genes of A/Puerto Rico/8/34 (PR8), the resulting A(H7N9) CVVs did not grow to sufficient titer in eggs. This would be problematic for rapid production of pandemic vaccine if the H7N9 viruses acquired the ability to transmit from person to person. Methods Several strategies were developed to improve the HA antigen yield of A(H7N9) CVVs from eggs. The approaches included evaluation of: (1) 3 alternative PR8 internal gene lineages; (2) modified non-coding region sequences (NCR); (3) chimerization of the H7 hemagglutinin protein with termini of H1 from PR8 virus and, (4) serial passage of the CVVs in embryonated eggs. The HA was quantified by isotope dilution mass spectrometry (IDMS) analysis of sucrose gradient-purified virions. Results The internal gene set from one PR8 virus lineage was identified to support higher hemagglutinin antigen yield from purified virus and was selected for subsequent studies. Further improvement of total viral protein yield was observed from several egg-passaged viruses; HA quantification by IDMS indicated a greater than two-fold increase in yield as compared to that of parental virus. Selected viruses were tested by hemagglutinin inhibition (HI) assays with ferret antisera to confirm that the antigenic characteristics remain unchanged. Investigation of further approaches exhibited little or no improvement in total viral protein yield. Conclusions If A(H7N9) viruses were to acquire sustained human to human transmissibility, the improved HA yield of the eggpassaged CVVs generated in this study could expedite vaccine manufacturing for pandemic mitigation. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P143 POSTE R A BSTRAC TS SPB5: GENETICS AND EVOLUTION OF VIRUS AND HOST SPB5P01 Adaptation of a human influenza virus to two mouse strains with different genetic backgrounds Stricker, Ruth L.O. (1); Leist, Sarah R. (1); Schughart, Klaus (1,2,3) 1: Helmholtz Centre for Infection Research, Department of Infection Genetics, Germany; 2: University of Veterinary Medicine, Hannover, Germany; 3: University of Tennessee Health Service Center, USA Background So far, adaptation of influenza viruses from one species to another has been studied intensively. However, it is not clear, if during the adaptation process to a new species, different virus variants become selected that depend on variant host factors within this species. We aimed to investigate, if upon adaptation of a human influenza isolate to mice a) the host genetic background influences selection of certain genetic variants, and b) different virus lineages adapted within individuals of the same mouse strain are identical. We chose the two mouse strains C57BL/6J and DBA/2J for this study. C57BL/6J mice are known to be more resistant to an influenza virus infection than DBA/2J mice. A human isolate was chosen for adaptation [A/Panama/2007/99 (H3N2)], which is not pathogenic in either mouse strain. Methods The Influenza A virus A/Panama/2007/99 (H3N2) was adapted as separate lineages in two mouse strains, C57BL/6J and DBA/2J mice by lung-to-lung passages. For this, mice were infected i.n. with 50μl virus, body weight was monitored every day and lungs were prepared on day three post infection. The lung homogenates were used for infection of the next passage. A total of ten passages were performed. The tenth passage of each lineage was grown on MDCK cells, titrated and sequenced by Next Generation Sequencing. C57BL/6J and DBA/2J mice were infected with the mouse-adapted virus lineages and body weight and survival were monitored for 14 days post infection. Results We established two lineages of adapted virus by lung-to-lung passage in C57BL/6J and five lineages in DBA/2J mice. The difference between body weight before infection and on day three post infection increased from passage to passage in DBA/2J mice, but almost no difference in body weight loss upon subsequent passaging was observed in C57BL/6J. The tenth passage of mouse-adapted virus lineages showed a broad range of virulence, from very mild to severely pathogenic in C57BL/6J and DBA/2J, whereas DBA/2J mice exhibited more severe phenotypes. Sequence analysis revealed that most mutations appeared in the globular head of HA. Mutations acquired in C57BL/6J lineages were different from the ones in DBA/2J lineages. Conclusions The host genetic background influences the selection of certain genetic variants. Some mutations that were acquired in the viral genome by repeated adaptation in one mouse strain were identical. In general it was observed that in the more susceptible mouse strain DBA/2J viruses adapted faster than in a more resistant mouse strain C57BL/6J. This can be explained by fact that viruses can replicate to higher titers in DBA/2J mice and with increased virus replication cycles, viruses with adaptation mutations can establish themselves faster. Thus, DBA/2J mice may represent a well suitable strain for influenza virus adaptation. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P144 POSTE R A BSTRAC TS SPB5P02 Host-specific distribution of (+)-RNA secondary structures in segment 8 of influenza A viruses Vasin, Andrey (1,2); Petrova, Alexandra (1,2); Plotnikova, Marina (1); Klotchenko, Sergey (1); Egorov, Vladimir (1); Kiselev, Oleg (1) 1: Research Institute of Influenza, Russian Federation; 2: St-Petersburg State Polytechnic University Background RNA secondary structures play an important role in the life cycle of influenza A viruses (IAVs). There have been found at least two stable hairpin structures in the 82-148 and 497-564 nucleotide regions of the NS gene. Given that evolutionary changes in the NS gene are strongly associated with host adaptation, pathogenicity, and transmissibility, we analyzed the prevalence of stable hairpin structures in these regions among human as well as non-human IAVs. Methods The secondary structures of segment 8 (+)-sense RNAs from 10 097 human and 12 621 non-human IAV strains were predicted using RNAfold software. Sequences were aligned using MAFFT; phylogenetic analysis was carried out using the RAxML algorithm. Results Stable hairpins were found in the majority of avian, canine, and other host species IAVs. In equine IAVs, the presence of a hairpin was predicted only in the 82-148 region, while in swine IAVs a hairpin was predicted only in the 497-564 region for one third of the strains. As for human IAVs, hairpin structures were found only in the minority of isolates (such as H5N1, H7N7, and H1N11918). In order to perform a more detailed analysis of the RNA secondary structures in human and swine IAVs, we clustered the NS gene sequences according to the results of the phylogenetic analysis. In human IAVs, a hairpin in the 82-148 nucleotide region was predominantly predicted for H1N1 and H2N2, but not for H3N2 or H1N1pdm2009 viruses. Stable hairpins in both regions were found only in 17 H1N1 strains, including A/ Brevig Mission/1/1918, which were isolated before 1946. Hairpins were also predicted in both regions for viruses of avian origin, such as H5N1 or H7N7. In H1N1pdm2009 viruses with the NS gene of North-American classical swine origin, hairpins were not predicted. However, in Eurasian swine IAVs, hairpins were predicted in the 497-564 region. Finally, while hairpins were not found in the 82-148 region in classical swine and triple reassortant IAVs, they were predicted in the 497- 564 region for 52% of the strains (predominantly in classical swine IAVs. We also evaluated the NS hairpin distribution in human and swine IAVs that originated from the avian-origin ancestor NS gene of A/ Brevig Mission/1/1918 virus from different time periods. It would seem that the hairpin in the 497-564 region was eliminated in the process of adaptation from an avian to human host, while a not highly stable hairpin structure in the 82-148 region still remains in some IAV lineages (H1N1 and H2N2). Conclusions The predicted RNA secondary structures in the 82-148 and 497-564 nucleotide regions of the NS gene of IAVs show host-dependent distribution. Hairpins are common among avian IAVs, but seem to be eliminated or destabilized in human IAVs. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P145 POSTE R A BSTRAC TS SPB5P03 Changes in receptor binding properties of influenza A(H3N2) and influenza B viruses and their impact on antigenic characterization Lin, Yipu; Gu, Yan; Wharton, Stephen; Whittaker, Lynne; Gregory, Victoria; Li, Xiaoyan; Metin, Simon; Cattle, Nicholas; Daniels, Rodney; Hay, Alan; McCauley, John MRC, National Institute for Medical Research, United Kingdom Background Recent evolution of A(H3N2) viruses has been accompanied by marked changes in receptor binding properties as well as antigenicity. This evolution is reflected in the loss of agglutination of avian red blood cells (RBCs) and low isolation rates in eggs and MDCK cells. Poor receptor binding by the haemagglutinin (HA) resulted in the selection of mutations in the neuraminidase (NA) which contributed to agglutination of RBCs and so complicate interpretation of antigenic comparisons by haemagglutination inhibition (HI). We have analysed the changes in HA and NA genes occurring over recent evolution and during propagation and applied a microneutralization (MN) assay to complement the HI assay in distinguishing between differences conferred by alterations in receptor binding and true antigenic differences between viruses. Methods Viruses were passaged in MDCK cells or in hens’ eggs. Recombinant viruses were generated by reverse genetics. Receptor binding was quantified by measuring virus binding to receptor analogues using surface biolayer interferometry. An MN assay used high resolution imaging methods to estimate the infected cell population. The HI assay was carried out using guinea pig RBCs. Results Quantitative receptor binding assays showed that influenza A(H3N2) viruses isolated after 2001 recognise α2,3 sialic acid avian receptors at undetectable levels and binding to the human receptor analogue, α2,6-sialyl lactosamine, decreased by 200-fold over the period of 2001–2004. By 2010, associated with the substitution D225N in HA1, binding to the human receptor analogue had also become barely detectable under standard assay conditions. Associated with the drop in receptor avidity, many H3N2 viruses propagated in MDCK cells acquired substitutions in the NA at residues 148 or 151 which conferred NA-dependent haemagglutination that could be inhibited by oseltamivir or anti-NA antiserum. The inhibition of the agglutination of RBCs by anti-NA antibody impacts on the interpretation of the results of the HI assay. The optimized MN assay, in contrast to the HI assay, was insensitive to the amino acid substitutions in NA of A(H3N2) viruses and so can complement the HI assay in examining virus antigenicity. Influenza B viruses also show adaptive changes during cultivation that affect receptor avidity. We have examined the antigenic properties of influenza B viruses propagated in hens’ eggs or in cell culture in the MN assay. Changes acquired on culture were shown to have less impact on the antigenic characterisation of viruses using MN than using HI. Conclusions Changes in the receptor binding properties of the HA, through natural evolution or adaptation during cultivation, have resulted in difficulties with antigenic analysis of circulating strains using the HI assay. An improved neutralization assay has proved useful in complementing the HI assay to clarify the true antigenic relationships between viruses for both influenza A(H3N2) and influenza B viruses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P146 POSTE R A BSTRAC TS SPB5P04 Evolution of highly pathogenic avian influenza H7 virus from low pathogenicity precursors in ovo Hanna, Amanda (1,2); Howard, Wendy A (1); Núñez, Alejandro (1); Hicks, Daniel (1); Barclay, Wendy S (2); Banks, Jill (1) 1: AHVLA, United Kingdom; 2: Imperial College London, United Kingdom Background Outbreaks of highly pathogenic avian influenza virus (HPAIV) may result in the infection of millions of poultry, causing devastating disease and up to 100% mortality. Observations from natural outbreaks and laboratory experiments support the dogma that HPAIV can emerge from low pathogenicity avian influenza virus (LPAIV) precursors. HPAI can result from infection with some, but not all, H5 and H7 subtypes of AIV with the multi-basic cleavage site (MBCS) in the haemagglutinin (HA) gene being the main pathogenic determinant of HPAIV infection in chickens. We aimed to further understand viral mechanisms of HPAIV evolution through development of an in ovo model of LPAIV to HPAIV evolution. Methods Reverse genetics (RG) and wild type viruses containing different cleavage site (CS) motifs were inoculated and passaged in 14-day-old embryonated chicken eggs. RG viruses were based on A/chicken/England/11406/08 (H7N7) HPAIV. This is an example of a virus that has naturally evolved to high pathogenicity in the field from a LPAIV precursor containing a rare di-basic CS (DBCS). A wild type avian influenza A(H7N9) Chinese virus isolate (A/Anhui/1/13) was also passaged as an example of a globally significant circulating LPAIV. Embryos were harvested and screened for evolution to a HPAIV genotype and phenotype by DNA sequencing and immunohistochemistry (IHC) respectively. Results Isogenic RG viruses based on the H7N7 England isolate were rescued containing either a DBCS (H7N7DBCS) as seen in the putative LPAIV precursor or a more typical LPAIV single- basic CS (H7N7SBCS). After one passage, four out of nineteen embryos (21%) inoculated with the recombinant H7N7DBCS LPAIV evolved to a HPAIV. DNA sequencing confirmed the acquisition of a MBCS and influenza virus-specific IHC staining was present in embryo vascular endothelial cells. In contrast, DNA sequencing from embryos inoculated with the H7N7SBCS LPAIV showed the retention of the SBCS motif, although after two passages, two out of fourteen embryos (14%) exhibited IHC staining indicative of a HPAIV phenotype. Conclusions We present an in ovo model that can be used to understand the mechanisms behind the molecular evolution and emergence of HPAIV. In this system a H7N7 virus containing a SBCS is less able to mutate to HPAIV compared to those containing a DBCS. We now intend to use this model to define the minimum genetic requirements for acquisition of basic amino acids at the cleavage site, and assess the likelihood of a novel or emergent LPAIV to evolve into HPAIV. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P147 POSTE R A BSTRAC TS SPB5P05 Molecular peculiarities of influenza A and B viruses circulating in Russia during two epidemic seasons in 2012-2014 Komissarov, Andrey; Kosheleva, Anna; Fadeev, Artem; Elpaeva, Ekaterina; Mikhailova, Maria; Pisareva, Maria; Buzitskaya, Janna; Stukova, Marina; Danilenko, Daria; Konovalova, Nadejda; Eropkin, Mikhail; Grudinin, Mikhail Research Institute of Influenza, Russian Federation Background Continuous monitoring of variability of circulating influenza strains allows studying their relationship with vaccine strains as well as revealing mutations coding for drug resistance. Influenza viruses A of two subtypes (H1N1pdm09, H3N2) and B of Victoria and Yamagata lineages have circulated during 2012-2014 in Russia. Methods Virus isolation was performed in MDCK cell culture and 10-day-old chicken embryos (CE). More than 400 influenza A and B viruses were isolated from clinical specimens (nasopharyngeal swabs) during two epidemic seasons. Sequencing was carried out on ABI PRISM 3100-Avant Genetic Analyzer (Applied Biosystems, USA) with «BigDye Terminator Cycle Sequencing Kit v3.1». Processing and analysis of sequences was performed using Vector NTI v10.1.1 (Invitrogen) and MEGA 5 (PSU, USA) software. Method of maximum likelihood was used to build phylogenetic trees. Results HA gene phylogenetic analysis of influenza A(H1N1pdm09) viruses showed that all 2012-2014 strains were genetically homogenous and belonged to clade 6 (А/Saint- Petersburg/27/2011-like). Two strains contained substitution A141T in HA (Ca2). 2014 strains were distinguished in a separate subgroup 6B (A/South Africa/3626/2013) with substitutions K163Q (Sa) and A256T. Some analyzed strains had substitutions P189Q, L191P near HA receptor-binding site. All 2012-2014 A(H3N2) strains were A/Victoria/361/2011-like (subgroup 3C of A/Victoria/208/2009 clade) defined by S45N (leading to emergence of a new previously unknown potential glycosylation site), T48I, S145N, A198S, V223I и N312S in HA. Majority of strains bore substitution T128A in HA1 leading to the loss of glycosylation site. Strains with T128A substitution also had R142G in the HA antigenic site A. Some 2014 strains of subgroup 3C by HA belonged to subgroup 3B by their NA. All Russian influenza A strains were oseltamivir susceptible and adamantane resistant by their genetic structure. Neuraminidase sequences of all strains isolated in 2012-2014 contained N369K in the antigenic site 365-369 (N2 numbering). Some strains had D151N/G substitution in NA catalytic site. All strains of B/Victoria lineage circulating in Russia in 2012-2014 fell into clade 1A and had common substitution K209T in HA1 unlike B/Victoria strains isolated in the previous period that fell into clades 1A and 1B and had N197K and T199A substitutions in receptor-binding site. No intra-clade reassortant HA-1A/NA-4 was identified in these seasons. B/Yamagata lineage strains belonged to clade 2 (B/Brisbane/03/2007-like) and clade 3 (B/Wisconsin/01/2010-like) and bore R48K (in antigenic site BC), I150S (in BA), Y165N (in BB2), T181A (in BD). No changes conferring resistance to oseltamivir or zanamivir were found in influenza B strains isolated till 2014. Conclusions Influenza A and B viruses circulating in Russia in 2012-2014 were characterized by relative genetic homogeneity in groups. Early phylogenetic changes that could cause antigenic drift with further mutations were revealed. The obtained data demonstrated that different lineages co-circulated and interacted through intra-subclade HA and NA reassortment. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P148 POSTE R A BSTRAC TS SPB5P06 Phylogenetic and principal component analyses of influenza virus sequence data from the first five years (2009–2013) of the IRIS study show subtype distinct geographical patterns in global epidemics van der Vries, Erhard (1); Zhang, Jitao David (2); Boucher, Charles (1); Schutten, Martin (1) 1: Erasmus MC, Rotterdam, The Netherlands; 2: F. Hoffmann-La Roche Ltd, Basel, Switzerland Background Extensive virological and clinical data have been collected from patients participating in a global observational trial, the Influenza Resistance Information Study (IRIS; NCT00884117). We investigated the phylogenetics, IC50 to neuraminidase inhibitors (NAIs) and viral load of infecting viruses from baseline samples in Years 1–5 of IRIS. Methods Patients in Europe, North America, South-East Asia and Australia with influenza-like illness and/or a positive rapid test result for influenza had throat/nose swabs collected on Day 1 (day of study entry) for real-time RT-PCR analyses of influenza type, subtype and NAI resistance. Symptoms including fever were noted on diary cards. Positive samples were cultured, sequenced and tested genotypically and phenotypically for NAI resistance. Full-length haemagglutinin (HA), neuraminidase (NA) and matrix protein 2 (M2) sequences obtained from Day 1 samples from individuals infected with A/2009H1N1, A/H3N2 and influenza B viruses were analysed by principal component analysis (PCA) using concatenated HA, NA and M2 gene sequences. Temporal-spatial maps were constructed for A/H3N2 and A/2009H1N1 to study changes in IC50 and baseline viral load over time (between 2009 and 2013). Phylogenetic analysis was done by construction of maximum- likelihood trees. Results Sequences were obtained from 2983 patients: 1079 A/2009H1N1, 1035 A/H3N2, 581 B/Victoria and 288 B/ Yamagata. PCA plots from viruses split by continent confirmed the seeding phenomenon for A/H3N2 epidemics from Asia into North America and Europe. Seeding from Asia was also observed for B/Yamagata; however, this was not observed for A/2009H1N1 or B/Victoria. IC50 and viral load values both fluctuated over the course of the study. Conclusions Evolutionary history of influenza sequences collected in Years 1–5 of IRIS showed temporal and geographical patterns in virus distribution and temporal change in baseline viral load. Mutations correlated with change in NAI susceptibility were also identified. These are currently under analysis, together with additional phylogenetic analyses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P149 POSTE R A BSTRAC TS SPB5P07 Identifying Antigenic Regions of H9 Haemagglutinin of Avian Influenza Peacock, Thomas Philip (1,2); Reddy, Kolli B (1); Shelton, Holly (1); Barclay, Wendy S (2); Iqbal, Munir (1) 1: The Pirbright Institute, United Kingdom; 2: Imperial College London, United Kingdom Background The H9N2 subtype of avian influenza virus is endemic in poultry throughout much of Asia and North Africa. It poses an immediate threat to the poultry industry due to high morbidity and occasionally high mortality, as well as a potential threat to human health both in itself as well as through its reassortant progeny, the outbreaks of H7N9 and H10N8 in China being two recent examples. Antigenic drift in the haemagglutinin (HA) glycoprotein of H9N2 (the receptor binding protein and major antigen) leads to the loss of in-field vaccine efficacy. Our aim is to identify key amino acid motifs responsible for antigenic differences in H9N2 viruses to better understand the mechanism of antigenic drift. As a result we aim to improve vaccine seed strain selection and the development of broadly protective recombinant vaccines. Methods The coding regions of two genetically closely related but antigenically distinct H9N2 viruses were manipulated using reverse genetics techniques. Utilising site-directed mutagenesis and Gibson Assembly, a library of mutant HA genes were produced with single or multiple amino acids swapped between the antigenically distinct HAs. Using panels of monoclonal antibodies and chicken post-infection antisera raised against one of the selected H9N2 strains we determined critical residues for the antigenic properties of H9 HA. Results We observed that a short region constituting only 7 amino acid differences and located in the vicinity of the receptor binding site (near the 220 loop) was responsible for the majority of the antigenic differences between these viruses. Additionally we measured the individual contributions these amino acids have on the antigenic cross reactivity against both viruses. Conclusions Here we show that a small region with only a few amino acid changes is responsible for the bulk antigenic diversity observed between two H9N2 viruses. This information may help guide future vaccine seed-strain selection and could provide a starting point for producing broadly cross-reactive recombinant vaccines. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P150 POSTE R A BSTRAC TS SPB5P08 EPITOPE MAPPING OF THE HEMAGGLUTININ MOLECULE OF INFLUENZA B/YAMAGATA AND B/VICTORIA LINEAGE VIRUSES USING MONOCLONAL ANTIBODIES Sorokin, Evgenii; Tsareva, Tatiana; Sominina, Anna A.; Pisareva, Maria; Komissarov, Andrei; Kosheleva, Anna Research Institute of Influenza, Russian Federation Background Influenza is one of the most important infectious diseases in both industrial and developing countries. Influenza B virus strains cause epidemics in humans as H1 and H3 subtype strains of influenza A virus. Compared with influenza A influenza B virus is characterized by a low rate of antigenic change. Genetic reassortment, insertion and deletion are responsible for its evolution. Methods Selection of escape mutants (EM) was conducted as described previously (Kaverin N. et al., J. Virol. 2007; 81: 1291112917), antigenic analysis of viruses and EM was performed in HI test, sequencing of wild viruses and EM was conducted using BigDye Terninator v3.1 Cycle Sequencing Kit («Applied Biosystems», USA) and genetic analyzer GA3130 («Applied Biosystems», USA). EM were named as the corresponding monoclonal antibodies (MAb) used for their selection. Results For the identification of virus-neutralizing epitopes of influenza B virus (Yamagata lineage) the panel of six MAbs to HA1 molecule was used: two MAbs (4H7 and D9) directed to B/Panama/45/90 and four MAbs (10F4, 8Н11, 9А3 and 8Н3) to B/Florida/04/06 strain. They were used to select EM of the viruses. These MAbs were highly specific and reacted in HI and neutralization tests with viruses of Yamagata lineage only without any reactivity with B/Victorialike strains. Analysis of the deduced amino acid sequences of EM 4H7 identified the double amino acid substitution at residue V75I (site BE) and D150T (site BA, loop 150). The single amino acid substitution Y40H, H85Y, R149I (site BA, loop 150), N202K (site BB1, helix 190) and S242R (helix 240) were identified in EM 10F4, EM 8Н11, EM D9, EM 8Н3 and EM 9А3, respectively. Additionally, the panel of four MAbs to HA1 molecule of influenza B virus of Victorian lineage with high virusneutralizing activity was developed: two MAbs (5B7 and B/4H1) to B/Shandong/07/97 virus and two MAbs (9F1 and 11F8) to B/Malaysia/2506/04 strain. For identification of virus neutralizing epitopes in HA1 EM were selected using above indicated antibodies. EM 5B7, EM B/4H1(4) and EMB/4H1(6) had a single amino acid substitution H122N (site BD, loop 120), K203T and K203I (site BB1, helix 190), respectively. EM 11F8 and EM 9F1 (2) had a single amino acid substitution H122N and K203N, respectively; EM 9F1(1) had a double mutation A202E and A317V. Conclusions Identification of virus-neutralizing epitopes in changeable sites of viruses of both contemporary lineages is important for prediction of possible future evolution ways of influenza B virus. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P151 POSTE R A BSTRAC TS SPB5P09 Analysis of mammalian adaptation in Influenza from surveillance data Burke, David Francis; Smith, Derek J university of cambridge, United Kingdom Background The adaptation of avian influenza viruses with the ability to infect humans is an ongoing cause for concern and infections of humans with A/H5N1 continue. The recent outbreak of human infections of A/H7N9 influenza viruses in China in 2013 and 2014 and reports of human infections with H10 and H6 in Taiwan highlights the potential for emergence of influenza viruses previously not detected in humans. A major worry is that an increase of incidences of human infection with avian influenza could cause further mammalian adaptation which would eventually lead to sustained human-to-human transmission. Methods Mutations within IAV genomes which confers an increased stability, replication rate or affinity of binding within mammalian hosts would result in key mutations occurring more frequently in human infections. We have tested the null hypothesis that the observed frequency of amino acid substitutions within avian and human-infection A/H5N1 sequences are the same at all amino acid positions in all gene segments. Any selection pressure for adaptation in mammalian hosts would give rise to a low, statistically significant, p-value. Results This method is able to identify mutations (PB2: E627K, D701N) which are known to increase replication in mammalian cells or cause amantadine/rimantidine resistance (MP Ser31Asn, Val27Ala). Many other mutations, currently untested, have been identified, many of which are close to known sites of biological relevance. Conclusions Mutations which occur at significantly higher frequencies within sequences from human infections than within sequences from an avian source and thus should be identifiable using such a statistical analysis. This method can be applied to other subtypes of influienza such as H7 or H9. These data are useful in tracking evolutionary changes of influenza viruses and identifying strains which may possess an increased risk of human infection. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P152 POSTE R A BSTRAC TS SPB5P10 H1N1 IAVs exploited the co-translational insertion process to decrease their NA transmembrane domain hydrophobicity Dou, Dan; da Silva, Diogo V; Nordholm, Johan; Daniels, Robert Stockholm University, Sweden Abstract Bitopic (single-spanning) membrane proteins such as NA, HA and M2 are expected to have more stringent hydrophobicity requirements on their transmembrane domains (TMDs) than multi-spanning membrane proteins. However, we found that the strict hydrophobicity requirement applies to the HA and M2 TMDs, but not to the type II NA TMDs, which co-translationally insert and invert. To identify the factors responsible for this difference, natural NA TMDs of varying hydrophobicity, followed by increasing polypeptide lengths, were examined using mammalian cell localization and topology assays. Our results demonstrate that co-translational insertion is essential for the marginally hydrophobic NA TMDs to properly invert and localize to the plasma membrane. However, for NA with hydrophobic TMDs, that are similar to subtype 2, insertion and inversion can occur post-translationaly. In addition, we found the highly conserve positively charged cytoplasmic tail residue is required for the TMD inversion process likely explaining the viral morphology change that has been observed upon deleting the cytoplasmic tail. Thus, IAVs exploited the co- translational insertion process to enable the human N1 TMDs to become less and less hydrophobic overtime. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P153 POSTE R A BSTRAC TS SPB5P11 Influenza A and B intertypic reassortment is restricted by incompatible viral packaging signals Baker, Steven F. (1); Nogales, Aitor (1); Finch, Courtney (4); Tuffy, Kevin (1); Domm, William (1); Perez, Daniel R. (4); Topham, David J. (1,2,3); Martínez-Sobrido, Luis (1) 1: Department of Microbiology and Immunology, University of Rochester School of Medicine and Dentistry, USA; 2: New York Influenza Center of Excellence; 3: David H. Smith Center for Vaccine Biology and Immuology; 4: Department of Veterinary Medicine, University of Maryland College Park and Virginia-Maryland Regional College of Veterinary Medicine, USA Background Co-circulation of influenza A and B viruses among humans seems to provide an evolutionarily advantageous mixing-vessel for these two distinct, yet similar, viruses. However, intertypic reassortment, or swapping viral RNA segments between influenza A and B viruses, has never been observed through either epidemiological observations or forced attempts in laboratory settings. Recent discoveries suggest that viral ribonucleoprotein competition may contribute to this lack of reassortment. However, this hypothesis does not explain the inability of influenza A virus to incorporate influenza B virus hemagglutinin (HA) or neuraminidase (NA) in the absence of intertypic competition. Methods We first observed compatibility of full-length influenza B HA (BHA) protein with influenza A virus using a single-cycle infectious Influenza A Virus (sciIAV). This virus contains modified HA viral RNA, in which GFP replaces the majority of the viral glycoprotein open reading frame, except for the non-coding regions (NCR) and packaging signals (Ψ) at both viral RNA segment termini. Growth of sciIAV was achieved in vitro using trans-complementing HA- expressing cell lines. To further explore the ability of BHA to be incorporated into replication-competent viruses, we appended the NCR and Ψ of influenza A HA and NA onto BHA and BNA to rescue recombinant viruses. In vitro and in vivo analysis of recombinant viruses tested relative fitness as well as incorporation into other influenza A viruses in co-infection tissue culture experiments. Results We observed that full-length BHA from multiple lineages could complement two influenza A (H1N1) viruses. Also, influenza A virus HA or NA packaging signals were sufficient to incorporate BHA or BNA into replication- competent influenza A viruses. We were able to rescue sciIBV using influenza B viral RNA regions that may comprise the BHA Ψ. Consequently, both sciIAV and sciIBV restricted incorporation of a reporter GFP gene flanked with the NCR and Ψ of the opposite virus. Lastly, influenza A viruses containing BHA and BNA were efficiently rescued and proved to be immunogenic in mice, and retained the ability to reassort in vitro with another strain of influenza A (H1N1) virus. Conclusions When influenza A and B viral segments encode proteins compatible with both viruses, packaging signal incompatibility inhibits intertypic reassortment. Although these packaging signal disparities likely arose gradually during evolutionary divergence, it provides an additional barrier for influenza type speciation. Our findings suggest that influenza A and B virus use similar mechanisms to specifically incorporate segments into budding virions. To determine the mechanism of specific genome packaging, it may be beneficial to study both types of influenza viruses. Additionally, these findings can be applied to the design of more efficient vaccine platforms, where one virus backbone is used to generate all HA and NA (sub)types included in quadirivalent vaccine formulations. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P154 POSTE R A BSTRAC TS SPB5P12 Use of deep-sequencing to evaluate the intrinsic heterogeneity of human influenza type A viruses directly in nasal swabs Barbezange, Cyril (1); Blanc, Hervé (2); Isakov, Ofer (3); Enouf, Vincent (1); Shomron, Noam (3); van der Werf, Sylvie (1); Vignuzzi, Marco (2) 1: Unit of Genetics of RNA Viruses, Institut Pasteur, UMR3569 CNRS, Univ Paris Diderot Sorbonne Paris Cité, France; 2: Unit of Viral Populations and Pathogenesis, Institut Pasteur, UMR3569 CNRS; 3: University of Tel-Aviv, Sackler Faculty of Medicine, Department of Cell and Developmental Biology, Tel-Aviv, Israel Background In 2009, a new influenza type A virus of the H1N1 subtype (H1N1pdm09) caused the first pandemic of the 21st century. It replaced the previously circulating H1N1 virus and, along with the H3N2 subtype, is now responsible for the seasonal influenza epidemics. The genome of influenza type A viruses is composed of eight single-stranded RNA segments of negative polarity. RNA virus polymerases are considered to have low fidelity and a virus thus exists as a cloud of closely-related sequences (referred to as a quasispecies). So far, the evolutionary potential of influenza viruses has been mainly documented by consensus sequencing data and the quasispecies nature of influenza viruses gained interest only recently with the development of Next Generation Sequencing (NGS) technologies. Materials and Methods The whole-genome genetic heterogeneity of the three subtypes of influenza type A viruses that circulated in humans between 2007 and 2012 in France was analysed using specimens, collected from mild and severe human cases of influenza corresponding to each subtype, The eight RNA segments of the viral genome was amplified by PCR after RNA extraction and specific reverse transcription. Library preparations and Illumina GAII runs were performed by multiplexing 6 samples per lane (2 tags per sample). Using bioinformatics tools developed for this purpose, short sequences generated by Illumina technology were aligned to the respective reference sequences and underwent different quality controls. The outputs giving the proportions of each base at each nucleotide position were then used for analysis and comparison. Results Overall mutation frequencies and gene-specific mutation frequencies were first analysed to identify subtype / severity signatures for each virus subtype (pandemic H1N1, seasonal H3N2, seasonal H1N1) or each severity group (mild versus severe within each subtype) and nucleotide polymorphisms were determined. Subtype-specific positions in apparently similar proportions exist for all the samples of the given subtype we tested. Finally, common or divergent positions between viruses of the two severity groups we searched for to try to identify sub-populations that could be landmarks of the severity. Conclusions Using a significant number of samples for three influenza viruses that have been circulating in the human population for the past 6 years this study provides information on the intrinsic heterogeneity of influenza viruses within the human host. It will lead to further studies aiming at understanding more precisely how the viral quasispecies nature is involved in evolution, pathogenicity and adaptability of influenza viruses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P155 POSTE R A BSTRAC TS SPB5P13 Strain specificity of serum hemagglutination-inhibition antibody responses in humans infected with 2009 pandemic influenza A(H1N1) virus Xiuhua Lu, Feng Liu, Vic Veguilla, Min Levine, and Jacqueline M Katz Influenza Division, NCIRD, Centers for Disease Control and Prevention, USA. Background Exposure to influenza viruses in childhood influence future antibody responses to antigenically distinct viruses within a subtype. The emergence of 2009 pandemic influenza A(H1N1) [A(H1N1)pdm09] virus provided an opportunity to understand the complex interplay between influenza virus exposure and subsequent antibody responses. Here, we characterized the serum hemagglutinin-inhibition (HI) antibody responses among A(H1N1)pdm09 virus-infected patients of different ages and priming histories with former seasonal influenza A(H1N1) viruses circulating between 1977 and 2009. Methods Sera collected from US residents prior to the 2009 pandemic (n=343) and sera from A(H1N1)pdm09 virus-infected persons were tested by HI assays using 0.5% turkey erythrocytes and 4 HA units (HAU) of virus against nine former seasonal H1N1 (sH1N1) viruses circulating from 1977 to 2009 and an A(H1N1)pdm09 virus. To evaluate the relative proportions of strain-specific versus cross-reactive antibodies, sera were adsorbed with 105 HAU of selected purified viruses and retested by HI assay. Results The unique HI reactivity patterns of sera collected prior to the 2009 pandemic were identified; three distinct sH1N1 priming patterns were observed. Most children (median age 9 yrs; n=80) showed the highest antibody titers against A/New Caledonia/20/99 (NC/99)-group viruses (NC/99-group-primed). Most young adults and a few older children (median age 23 yrs; n=144) showed the highest antibodies to A/Taiwan/1/86 (TW/86)-group viruses (TW/86group-primed). Most adults (median age 39 yrs; n=119) exhibiting broad HI activity and were likely primed with A/ USSR/90/77 (USSR/77)-group viruses. Serologic evidence of sH1N1 exposure(s) could be used for determining the priming sH1N1 virus in individuals with various ages. Sera from 113 A(H1N1)pdm09-infected individuals (6-49 years old) were similarly grouped into one of the above three priming patterns and then sera were adsorbed with A(H1N1)pdm09, the relevant priming former sH1N1, and PBS as control. Infection with A(H1N1)pdm09 virus in NC/99-group-primed patients produced predominantly strain-specific HI antibodies. In contrast, the majority of patients who were primed with TW/86-group viruses or USSR/77-group viruses produced predominant cross-reacting antibodies. Paired sera from 114 A(H1N1)pdm09-infected individuals (4-49 years old) were tested by cross-HI assays against sH1N1 viruses and an A(H1N1)pdm09 virus. The NC/99-group-primed patients (median age 14 yrs; n=15) showed significant rise of HI titers to A(H1N1)pdm09 virus but not to any sH1N1 viruses. However, some TW/86-groupprimed patients (median age 24 yrs; n=55) or USSR/77-group-primed patients (median age 39 yrs; n=44) showed significant rise to one or more or all sH1N1 viruses tested. Conclusion Age and priming history with different former sH1N1 viruses impacted HI antibody formation following A(H1N1) pdm09 virus-infection. Dampening of strain-specific antibody and enhancement of cross-reacting HI antibodies occurred in the majority of TW/86-group-primed and USSR/77-group-primed individuals. These data highlight potential differences in the quality of HI antibody responses to A(H1N1)pdm09 virus-infection that may have implications for protective immunity. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P156 POSTE R A BSTRAC TS SPB5P14 Comparison of common genotypes of Chinese H7 avian influenza viruses for replication and transmission in chickens David L. Suarez and Marisela Rodriguez Southeast Poultry Research Laboratory, USDA, Athens, GA 30605 Background In 2013 an outbreak of H7N9 was detected in humans and in poultry in China. Additionally H7N7 virus was also found in poultry in China. Both groups of viruses appeared to be reassortant viruses having picked 6 internal gene segments from the poultry adapted H9N2 that is endemic in China and having likely acquired the hemagglutinin and neuraminidase genes from wild birds. With both groups of viruses, numerous polymorphisms were present including 3 changes in the hemagglutinin protein. One of the changes at position 217 is in the receptor binding site that typically impacts whether the virus attaches to alpha 2,3 (avian-like) or alpha 2,6 (human-like receptors) that are predicted to affect virus replication. Two other changes were found in the human isolate that is rarely found in poultry isolates. Methods Studies were performed using reverse genetics or natural mutations of both the H7N9 and H7N7 Chinese viruses to examine virus replication and transmission in chickens. In addition variant viruses with these combinations of three amino acid were also tested to see if they would affect virus replication and direct virus transmission. Studies were performed in 4 week old chickens by directly inoculating some chickens and then adding naïve chickens to the same cage 2 days later. Samples from both directly inoculated and transmission birds were also directly sequenced to determine if viruses mutated to any particular genotype. Results Four different H7N9 viruses isolated from humans were tested, and all the viruses infected chickens, but did not transmit to other chickens efficiently at the standard challenge dose of 10^6. All the human viruses had leucine at position 217 (H7 numbering). Sequence from challenged birds showed a change in amino acid sequence from leucine to glutamine, which is the amino acid typically found in avian H7 viruses. Transmission was seen at the higher doses, with some evidence of increased replication and transmission in birds given virus variants with glutamine at position 217. Conclusions There appears to be strong selection pressure for human viruses to have leucine at position 217, which is associated with receptor binding to alpha 2,6 sialic acid, which is the predominant form found in humans. Chickens, which primarily have alpha 2,3 sialic acid, appear to select for viruses with glutamine at that position, which is the type found in almost all H7 avian influenza viruses. Although some differences were seen in transmission that seems to correlate to position 217, the data is not clear enough to make firm conclusions. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P157 POSTE R A BSTRAC TS SPB5P15 Sequencing artifacts in the type A influenza database and attempts to correct them David L. Suarez (1), and Nikki Chester (2), 1: Exotic and Emerging Avian Disease Research Unit, Southeast Poultry Research Laboratory, Agricultural Research Service, USDA, 934 College Station Road, Athens,GA 30605, 2: Athens Academy, 1281 Spartan Lane, Athens, GA 30606 Background Type A influenza virus causes a wide range of disease in both man and animals, and considerable efforts have been made to study and sequence large numbers of isolates. Currently there are over 300,000 gene sequences representing over 50,000 strains in publicly available databases. However, the quality of the sequences submitted to these public databases are determined by the contributor and many sequence errors are present in the databases, which can affect sequence analysis and require significant curation of data by individual researchers to get usable data. As part of a high school class project, bioinformatics analysis was performed on all eight gene segments of influenza A virus. Material and Methods Sequences were selected in the Influenza Research Database website that were longer than the generally accepted lengths of the individual segments, with the hypothesis that these sequences would have an error in the sequence. Multiple sequence alignments were performed for each segment, and viral sequences. The virus sequences were evaluated for common types of error associated with each sequence. Results A total of 1081 sequences were identified that met this criteria when the database was queried in March 2012, which represents a 0.82% rate of potential errors.Three types of errors were commonly observed: non-influenza primer sequence was not removed from the sequence; Taq polymerase added an adenine at the end of the PCR product; and the PCR product was cloned and plasmid sequence was included in the sequence. Internal insertions of nucleotides was also commonly observed, but in many cases it was unclear if the sequence was correct or actually contained an error and therefore these sequences were not evaluated further. Students contacted some of the sequence submitters alerting them that a sequence had been identified as likely having an error and if known what type of error it probably was and asked to correct it. A total of 215 sequences, or 22.8% of the suspect sequences, were corrected in the public databases in the past year in part because of the student project. Examination of the sequence database in 2013-14 showed an additional 409 sequences with possible errors were added to GenBank in the last year. Conclusions The integrity of the public sequence databases is largely dependent on the scientists who submit the sequence information. The identification of 409 new problematic sequences in the last two year highlights that errors are still commonly reported. Additional awareness of the need for data integrity of sequences submitted to public databases is needed to fully reap the benefits of the huge amount of data available for analysis. SPA6: EVALUATION OF VACCINE SAFETY AND EFFECTIVENESS TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P158 POSTE R A BSTRAC TS SPA6P01 Effectiveness of influenza and pneumococcal vaccines in preventing pneumonia development and hospitalization: a prospective cohort study Song, Joon Young (1,10); Lee, Jin Soo (2); Wie, Seong-Heon (3); Kim, Hyo Youl (4); Lee, Jacob (5); Seo, Yu Bin (5); Jeong, Hye Won (6); Kim, Shin Woo (7); Lee, Sun Hee (8); Park, Kyung Hwa (9); Noh, Ji Yun (1,10); Choi, Won Suk (1); Cheong, Hee Jin (1); Kim, Woo Joo (1,10) 1: Korea University College of Medicine, Korea, Republic of (South Korea); 2: Inha University School of Medicine; 3: Catholic University Medical College, St. Vincent’s Hospital; 4: Yonsei University, Wonju College of Medicine; 5: Hallym University College of Medicine; 6: Chungbuk National University College of Medicine; 7: Kyungpook National University School of Medicine; 8: Pusan National University School of Medicine; 9: Chonnam National University Medical School; 10: Transgovernmental Enterprise for Pandemic Influenza in Korea (TEPIK) Background Pneumonia and acute exacerbation of chronic illness are leading causes of influenza-related hospitalization, particularly among patients with comorbidities. Therefore, influenza and pneumococcal vaccinations are strongly recommended for the adults with comorbidities. Methods Using hospital-based influenza surveillance system (Hospital-based Influenza Morbidity and Mortality, HIMM), we performed a multicenter, prospective cohort study of patients visiting emergency room with influenza-like illness during the influenza epidemic period in 2013-2014. Patients aged ≥18 years were included, and clinical data were collected regarding vaccination status (influenza and pneumococcus), comorbidities, complications, hospitalization and mortality. Multivariate analyses were performed to estimate the effectiveness of influenza and pneumococcal vaccination in preventing pneumonia development and hospitalization. Results Between 1 November 2013 and 30 April 2014, 2,217 patients with ILI were registered, and 44.6% (988 patients) were laboratory-confirmed as influenza. Among 2,217 patients, 31.9% (707 patients) and 9.7% (216 patients) were immunized by influenza and pneumococcal vaccine, respectively. The adjusted influenza vaccine effectiveness for preventing pneumonia development and hospitalization were 58.0% (odds ratio 0.420, 95% CI 0.211-0.834) and 39.8% (odds ratio 0.602, 95% CI 0.430-0.842), respectively. Pneumococcal vaccination did not reduce the development of pneumonia (odds ratio 1.450, 95% CI 0.672-3.126) and hospitalization (odds ratio 1.077, 95% CI 0.707-1.643). Conclusions Influenza vaccination was associated with a reduction in the risk of pneumonia development and hospitalization during influenza season. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P159 POSTE R A BSTRAC TS SPA6P02 Influenza vaccine effectiveness to prevent admissions with influenza in adults belonging to target groups for vaccination in the Valencia Hospital Network. A test-negative study, 2013-2014 influenza season Puig-Barberà, Joan (1,2); Carballido-Fernández, Mario (3); Limón-Ramírez, Ramón (4); Tortajada-Girbés, Miguel (5); Otero-Reigada, María Carmen (6); Mollar-Maseres, Juan (6); Carratalá-Munuera, Concha (7); Gil-Guillén, Vicente (7); Natividad-Sancho, Angels (1); Tormos, Anita (1); Buigues-Vila, Amparo (1); Mira-Iglesias, Ainara (1); López-Labrador, Francisco Xavier (1,8); Díez-Domingo, Javier (1) 1: FISABIO-Salud Pública, Valencia, Spain; 2: Centro de Salud Pública de Castellón, Castellón, Spain; 3: Hospital General, Castellón, Spain; 4: Hospital La Plana, Vila-real, Spain; 5: Hospital Dr Peset, Valencia, Spain; 6: Hospital La Fe, Valencia, Spain; 7: Universidad Miguel Hernández, San Juan de Alicante, Spain; 8: CIBERESP, Instituto de Salud Carlos III, Madrid, Spain Background Influenza is associated with excess morbidity preventable by vaccination. Vaccinating risk groups is considered the Influenza is associated with excess morbidity preventable by vaccination. Vaccinating risk groups is considered the best preventive strategy. Because of antigenic drift of the virus and acquired immunity, vaccine effectiveness (VE) is variable and questioned. Our aim was to estimate influenza VE to prevent admissions related to influenza in immunized adults belonging to risk groups, coinciding with the 2013-2014 influenza season, in Valencia (Spain). Methods This was a hospital-based, test-negative, case-control study. We enrolled consenting, non-institutionalized subjects, aged 18 or over, belonging to target groups for vaccination, consecutively admitted for acute processes related to influenza in six participating hospitals, with influenza-like-illness (ILI) symptoms within seven days of admission. We obtained pharyngeal and nasopharyngeal swabs within seven days of symptom onset in 97% of enrolled subjects. We considered as cases those RT–PCR positive for influenza and as controls those with a negative result. We ascertained vaccination by recall and by consulting the Valencia population based Vaccine Information System. We considered a subject as immunized when vaccinated 15 or more days before ILI onset. We estimated influenza VE unadjusted and adjusted by age, sex, previous admissions, days between onset of symptoms and swabbing, hospital and epidemiological week when hospitalized. Results From week 52-2013 to week 11, 2014, we enrolled 1,172 subjects. In four, the sample was inadequate, leaving 1,168 subjects for analysis. Overall, 260 (22%) were influenza positive and considered cases, 201 (77%), A(H1N1)pdm; 54 (21%), A(H3N2 ); and 5 (2%), A not subtyped; 908 (78%) were negative controls. The risk (odds ratio [OR]; 95% confidence interval [95CI]) of hospitalization with influenza was higher in subjects younger than 65, OR, 2.2 (95%CI, 1.6 to 2.9); pregnant women, OR, 13.3 (2.1 to 85.0); with morbid obesity, OR, 5.3 (1.1 to 25.5); or in current smokers, OR 1.8 (1.3-2.5). Vaccination was positively associated with age 65 and over, cardiovascular disease, bronchitis, two or more visits to GP, previous admissions, not being a current smoker and previous influenza vaccination, and negatively associated with being a current smoker or pregnant. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P160 POSTE R A BSTRAC TS Compared to 44% cases, 59% controls were immunized (p < 0.0001). The unadjusted influenza VE was 46% (95%CI; 28% to 59%). The adjusted VE was 32% (95% CI, 7% to 50%). Conclusions The vaccine conferred moderate protection against the risk of admission with influenza in adults belonging to target groups. The adjusted estimate indicates that among immunized it prevented one in three admissions with influenza. Funding Sanofi Pasteur funded the study. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P161 POSTE R A BSTRAC TS SPA6P03 Influenza vaccine effectiveness and averted medically-attended influenza cases, seasons 2011/12, 2012/13 and 2013/14 Reuss, Annicka; Buda, Silke; An der Heiden, Matthias; Schweiger, Brunhilde; Wedde, Marianne; Haas, Walter; Buchholz, Udo Robert Koch Institute, Germany Background Influenza viruses evolve constantly and therefore the effectiveness of influenza vaccines (IVE) needs to be assessed through observational studies each season. Our study objective was to estimate IVE against laboratory confirmed influenza A(H1N1)pdm09, A(H3N2) and B in the German population and the number of potentially averted medically-attended influenza (MAI) cases during the seasons 2011/12, 2012/13 and 2013/14. Methods We conducted a test-negative case-control study among outpatients with influenza-like-illness (ILI) whose nasal swabs were tested by the national reference laboratory during the seasons 2011/12- 2013/14. Cases had laboratoryconfirmed influenza, controls were influenza-negative. We calculated IVE adjusted for age group and week of symptom onset using multivariable logistic regression. Combining season-specific point estimates of IVE with the estimated number of MAI cases allowed us to roughly calculate the subtype-specific number of potentially averted MAI cases. We also took into account vaccination coverage, influenza attack rates and population size. Effects of herd immunity were not considered. Results Depending on (sub)-type and season, point estimates of IVE against laboratory confirmed influenza ranged between 0% and 59% (figure). IVE against A(H1N1)pdm09 was 52% and 59%, against A(H3N2) 0% and 49% and against B 24% and 27%. The estimated total number of MAI cases were 1.1 million (2013/14), 2.1 million (2011/12) and 7.7 (2012/13), corresponding to 1-9% of the Germany population. In 2012/13, a season with high influenza activity, seasonal influenza vaccination potentially averted almost a million MA influenza cases (table). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P162 80 70 60 50 40 30 20 10 0 IVE estimate in 2013/14 was assumed 0% for calculation 90 * * * no IVE estimate in 2011/12 due to few cases 100 no IVE estimate in 2011/12 due to few cases Influenza Vaccine Effectiveness (%) POSTE R A BSTRAC TS 1 2011/12 2 2012/13 2 2013/14 * 95%‐CI includes negative values * 0 A(H1N1)pdm09 A(H3N2) B 1 1 2 2 3 * 3 Study characteristics and estimates 2011/12 2012/13 2013/14 No. of ILI‐patients (influenza cases/controls) 2,002 (501/1,501) 2,129 (1,190/939) 1,033 (165/868) Vaccination rate among influenza cases/controls 5%/8% 7%/8% 11%/8% Proportion of A(H1N1)pdm09/A(H3N2)/B 1%/76%/23% 34%/30%/36% 28%/63%/9% Estimated MAI cases 2,100,000 7,700,000 1,100,000* Potentially averted MAI cases 334,000 917,000 0 * preliminary data Conclusions Conclusions estimated thatthat seasonal influenza vaccination low to moderate protection WeWeestimated seasonal influenzaprovided vaccination provided lowdepending to moderate protection depending on (sub)-type on (sub)-type and season. Low vaccination rate in our study population prevented analysis for and season. Low vaccination rate in our study population prevented analysis for vaccination target groups. During vaccination target groups. During influenza epidemics, physicians should consider influenza as influenza epidemics, physicians should consider influenza as diagnosis among patients with ILI, irrespective of diagnosis among patients with ILI, irrespective of vaccination status. Despite a low to moderate vaccination status. Despite a lowmay to have moderate influenza vaccination may have prevented a protection, seasonal influenza vaccination preventedprotection, a substantial seasonal number of MA influenza cases. substantial number of MA influenza cases. 2 TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P163 POSTE R A BSTRAC TS SPA6P04 Vaccine effectiveness estimates in preventing laboratory-confirmed mild and moderate-to-severe influenza in the Belgian population during the 2012-2013 season Hombrouck, Anneleen (1); Bossuyt, Nathalie (2); Van Casteren, Viviane (2); Van Gucht, Steven (1); Quoilin, Sophie (2); Wuillaume, Françoise (2); Thomas, Isabelle (1) 1: Scientific Institute of Public Health, Operational Directorate of Communicable and Infectious Diseases, Viral Diseases, Brussels, Belgium; 2: Scientific Institute of Public Health, Operational Directorate of Public Health and Surveillance, Brussels, Belgium Background The influenza season 2012-2013 in Belgium was characterized by a very high intensity and duration as compared to previous seasons. Three viruses co-circulated: A(H1N1), A(H3N2) and B with a predominance of A(H1N1) and B of Yamagata lineage. Methods Mild cases of influenza were monitored through a sentinel network of 112 general practitioners (GPs), which reported and sampled patients of any age who met the influenza-like-illness (ILI) case definition: sudden onset of symptoms, fever (≥38°C), respiratory and systemic symptoms. Moderate-to-severe influenza cases were monitored through a sentinel network of 6 hospitals, which reported and sampled patients with severe acute respiratory infections (SARI), which were defined as patients of any age with an acute respiratory illness with onset within the last seven days and fever of ≥ 38°C (or history of fever) and cough or dyspnoea, and requiring hospitalisation (24h or more). Patients with swabs taken >7 days of symptoms onset and patients with no record of vaccination (date) or vaccination <14 days before symptoms onset were excluded. We used a test-negative design and compared labconfirmed influenza-positive to influenza-negative patients with mild or moderate-to-severe illness. Using logistic regression, we calculated adjusted vaccine effectiveness (AVE) by type/subtype and results were adjusted for surveillance scheme (if applicable), age group, sex and month of sample collection. Results During the 2012-2013 season, 1425 samples from ILI and 1001 samples from SARI patients were collected. After applying exclusion criteria, we included 1261 ILI patients and 665 SARI patients in the vaccine effectiveness (VE) analysis. Overall trivalent influenza vaccine (TIV) adjusted VE against laboratory-confirmed influenza (mild and moderate-to-severe cases) was estimated 39% (95%CI 17%-54%). TIV adjusted VE against influenza A(H1N1) was 48% (95%CI 20%-67%) and influenza B was 44% (95%CI 19%-61%). Data power was not sufficient to calculate TIV adjusted VE for influenza A(H3N2). When comparing laboratory-confirmed mild influenza to moderate-tosevere influenza, overall TIV adjusted VE against mild influenza was estimated 42% (95%CI 12%-63%) and against moderate-to- severe influenza was 35% (95%CI 0.7%-57%). TIV adjusted VE against mild influenza A(H1N1) alone was 51% (95%CI 0.6%-65%) and against moderate-to-severe influenza A(H1N1) was 47% (95%CI 0.3%-71%). TIV adjusted VE against mild influenza B alone was 56% (95%CI 27%-75%). The adjusted VE estimate against moderateto-severe influenza B was lower but the effect was not significant. Conclusions Estimation of VE was feasible in Belgium for the 2012-2013 season, because the number of ILI and SARI samples collected in our routine surveillance systems were high due to the intensity of the epidemic. The data suggest a moderate protection by TIV against mild and moderate-to-severe influenza (subtype A(H1N1) and B) during the 2012-2013 season. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P164 POSTE R A BSTRAC TS SPA6P05 Immunogenicity and safety of AS03-adjuvanted H7 vaccines in adults ≤64 years of age: Phase I/II, randomized, observer-blind, placebocontrolled, multi-center trials in the United States and Canada Madan, Anu (1); Segall, Nathan (2); Ferguson, Murdo (3); Sheldon, Eric (4); Frenette, Louise (5); Chu, Laurence (6); Rheault, Paul (7); Kroll, Robin (8); Friel, Damien (9); Soni, Jyoti (10); Li, Ping (1); Innis, Bruce L. (1); Schuind, Anne (1) 1: GlaxoSmithKline Vaccines, King of Prussia, PA, USA; 2: Clinical Research Atlanta, Stockbridge, GA, USA; 3: Colchester Research Group, Truro, NS, Canada; 4: Miami Research Associates, Miami, FL, USA; 5: QT Research, Sherbrooke, QC, Canada; 6: Benchmark Research, Austin, TX, USA; 7: Medicor Research Inc., Sudbury, ON, Canada; 8: Seattle Women’s: Health, Research, Gynecology, University of Washington, Seattle, WA, USA; 9: GlaxoSmithKline Vaccines, Wavre, Belgium; 10: GlaxoSmithKline Pharmaceuticals Ltd., Bangalore, India Background Following reports of H7N9 human infections in China, GlaxoSmithKline Vaccines first evaluated an influenza A/ H7N1 (A/mallard/Netherlands/12/2000) vaccine as a model H7 influenza vaccine, and, following the availability of an H7N9 strain, has evaluated an A/H7N9 (A/Shanghai/2/2013) vaccine. Here we report immunogenicity and safety results after two-dose immunization in healthy adults with different formulations of these two vaccines. Methods The first co-primary objective of these two trials (H7N1/NCT01934127; H7N9/NCT01999842) was to evaluate whether two-dose vaccination, 21 days apart, with these monovalent vaccines containing nominal 3.75μg or 7.5μg of hemagglutinin (HA) adjuvanted with AS03 (Adjuvant System containing α-tocopherol [11.86mg or 5.93mg] and squalene in an o/w emulsion) results in an immune response (by hemagglutination inhibition [HI]) to the vaccinehomologous virus that meets CBER and CHMP guidance targets, 21 days post-dose 2 (Day 42). In each trial, ~420 subjects were randomized (1:1:1:1:1:2) to receive one of these four adjuvanted formulations, or a non-adjuvanted formulation containing 15μg HA, or a placebo. For each of the adjuvanted formulations that met the CBER and CHMP criteria, adjuvant effect was evaluated by comparing HI responses with the non-adjuvanted 15μg formulation. The second co-primary objective was to assess safety/reactogenicity of the different vaccine formulations through Day 42. Solicited and unsolicited adverse events (AEs) were recorded for 7 and 21 days after each dose, respectively. Medically attended AEs (MAEs), potential immune-mediated diseases (pIMDs) and serious AEs (SAEs) are presented up to Day 42. Immunogenicity and safety follow-up up to 12 months post-vaccination is ongoing. Results In both trials, 21 days after the second dose, immune responses to all adjuvanted formulations, regardless of the antigen dose or adjuvant, met CBER and CHMP criteria. The adjuvant effect was demonstrated for both vaccines. In the H7N1 trial, a robust cross- reactive immune response to H7N9 was also observed. In both trials, pain was the most common solicited injection site symptom and muscle ache, headache and fatigue were the most common solicited general symptoms. A higher reactogenicity was seen with the adjuvanted formulations. Also, a trend for higher reactogenicity was seen with the H7N9 compared to the H7N1 vaccine formulations. Occurrence of unsolicited AEs and MAEs up to Day 42 was similar across all groups (adjuvanted, non-adjuvanted, placebo). Five days after the administration of the second dose in the H7N1 trial, 1 SAE was reported (acute pancreatitis), assessed by the investigator as not causally related to vaccination and resolved before the Day 42 visit. No pIMDs were reported. Conclusions Primary objectives for both studies were met: CBER and CHMP criteria were met in all adjuvanted groups, 21 days after the second vaccine dose of either H7N1 or H7N9 vaccine. In both trials, the study vaccines were generally well tolerated. Funding BARDA+GlaxoSmithKline Biologicals SA TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P165 POSTE R A BSTRAC TS SPA6P06 The «forgotten antigen» of Influenza virus: a novel approach to study immunity to neuraminidase Prevato, Marua (1); Nandi, Avishek (3,4); Lilja, Anders (4); Giusti, Fabiola (1); Ferlenghi, Ilaria (2); Buccato, Scilla (2); Cozzi, Roberta (2); Giovani, Cinzia (2); Maione, Domenico (2); Brito, Luis (4); Geall, Andrew (4); Montomoli, Emanuele (1); Bertholet, Sylvie (2); Legay, Francois (2); Bonci, Alessandra (2) 1: University of Siena, Italy; 2: Novartis Vaccines, Siena, Italy; 3: Vaccine Research, Holly Springs, USA; 4: Vaccine Research, Cambridge, USA Background A detailed understanding of anti-neuraminidase (NA) immunity is not currently available due to a lack of suitable tools to measure functional anti-NA antibodies. Currently available assays rely on hemagglutinin (HA) mismatched reassortants (1) or detergent treated viruses (2) as sources of NA to overcome interference issues associated with steric hindrance of anti-HA antibodies present in sera. The goal of this work is to setup an innovative EnzymeLinked Lectin Assay (ELLA) introducing NA pseudotyping as a simpler and easier method to generate sources of NA. Furthermore, we explored the immunogenicity of a SAM®(NA) vaccine (3), which is based on the non- viral delivery of a self-amplifying mRNA encoding the NA antigen from Influenza. Methods PseudoParticles (PPs) - Influenza PPs were generated by transfecting 293T cells with plasmids encoding for the structural proteins and the NA of A/California/7/2009 H1N1 or A/turkey/Turkey/01/2005 H5N1 viruses; PPs expressing both A/CA NA and the A/Vietnam/1194/04 mismatched H5 were also generated. Cell culture supernatants containing PPs were harvested and filtered before storage, and further analyzed by SDS-PAGE and western blotting for the presence of NA. NA activity and its inhibition were measured against a set of representative sera by ELLA assay. NA inhibiting (NI) titers were also measured using the whole live and the Triton X-100 treated viruses as sources of NA. SAM(NA) vaccine - The A/turkey/Turkey/01/2005 NA gene was cloned into the SAM vector, linearized, in vitro transcribed and capped. NA protein expression was confirmed by western blotting and functional activity by an ELLA test before being formulated with lipid nanoparticles and injected to mice intramuscularly. Functional anti-NA antibodies were assayed in sera from immunized mice by ELLA assay. Results All preparations of PPs containing NA showed sialidase activity and were used as virus surrogate in the ELLA assay to specifically measure functional anti-NA antibodies in a set of representative sera. Preparations expressing NA alone or combined with the mismatched HA gave comparable NI titers. In contrast, titers measured using the whole live virus were subjected to anti-HA antibody interference and NI titers obtained using Triton X-100 treated virus were lower possibly because of the action of the detergent on the structure of NA. Immunization of mice with the SAM(NA) vaccine generated an NA-specific antibody response, which was shown to have functional activity in a novel and innovative ELLA assay. A dose response effect was observed when administering increasing amount of RNA. Conclusions Our results highlight that a PPs-based NI assay has great potential to be developed as a sensitive, flexible, and easy to handle and scale up serological tool to study immunity to NA. Moreover, the SAM technology is suitable to set up new in vivo studies to better understand the role of NA immunity after infection or vaccination. Bibliografie (1) Sandbulte MR, et al. (2009) A miniaturized assay for influenza neuraminidase-inhibiting antibodies utilizing TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P166 POSTE R A BSTRAC TS reverse genetics-derived antigens. Influenza Other Respir Viruses, 3, 233-240. (2) Jonges N, et al. (2010) Influenza virus inactivation for studies of antigenicity and phenotypic neuraminidase inhibitor resistance profiling. J Clin Microbiol. 48(3), 928-940. (3) Deering RP, et al. (2014) Nucleic acid vaccines: prospects for non-viral delivery of mRNA vaccines. Expert Opin. Drug Deliv. 11(6). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P167 POSTE R A BSTRAC TS SPA6P07 Immunogenicity and safety of an AS03-adjuvanted H7N1 vaccine in an elderly population Madan, Anu (1); Ferguson, Murdo (2); Rheault, Paul (3); Seiden, David (4); Friel, Damien (5); Soni, Jyoti (6); Li, Ping (1); Innis, Bruce L. (1); Schuind, Anne (1) 1: GlaxoSmithKline Vaccines, King of Prussia, PA, USA; 2: Colchester Research Group, Truro, NS, Canada; 3: Medicor Reasearch Inc., Sudbury, ON, Canada; 4: Broward Research Group, Hollywood, FL, USA; 5: GlaxoSmithKline Vaccines, Wavre, Belgium; 6: GlaxoSmithKline Pharmaceuticals Limited, Bangalore, India Background Development of influenza virus vaccines for potentially pandemic A subtypes is part of the World Health Organization’s global strategy for pandemic preparedness. GlaxoSmithKline Vaccines developed an H7N1 influenza vaccine, considered as a model vaccine in the context of emerging H7N9. This phase II, observer-blind, randomised, placebocontrolled study in the United States and Canada (ClinicalTrials.gov: NCT01949090) assessed the immunogenicity and safety of different investigational monovalent A/mallard/Netherlands/12/2000 (H7N1) vaccine formulations in a population of elderly adults, which represents the age segment most impacted by H7N9 infections.Methods Adults ≥65 years of age in stable health were randomised (1:1:1:1:2) to receive 1 of 4 vaccine formulations (3.75 or 7.50μg hemagglutinin antigen (HA), each adjuvanted with AS03 (Adjuvant System containing α-Tocopherol (11.86 or 5.93 mg) and squalene in an o/w emulsion)) or saline placebo, administered as a 2-dose series (21 days apart). Immune responses to the vaccine-homologous (A/mallard/Netherlands/12/2000 [H7N1]) and vaccine- heterologous (A/Shanghai/2/2013 [H7N9], subset of subjects) strains were evaluated by hemagglutination inhibition (HI) assay at Days 0, 21 and 42. Solicited and unsolicited adverse events (AEs) were recorded for 7 and 21 days after each dose, respectively. Medically attended AEs (MAEs), potential immune-mediated diseases (pIMDs) and serious AEs (SAEs) are presented up to Day 42. Immunogenicity and safety evaluations up to 12 months post- vaccination are ongoing. Results Of the 360 vaccinated subjects, 334 were included in the per-protocol cohort for immunogenicity. Robust HI antibody responses were induced by all vaccine formulations, 21 days after the second dose. Strong cross-reactive immune responses were also observed to the heterologous strain (H7N9). While no particular effect of the antigen dose or adjuvant type was observed for the homologous responses, heterologous responses tended to be higher for the formulations with the highest adjuvant content, with no observed effect of the antigen dose. Pain was the most frequently reported injection site symptom (41.7%–65.0% of the H7N1 recipients). The most frequent general symptoms were fatigue, headache and muscle ache (reported by 16.7%–35.0% of the H7N1 recipients). Within 21 days post-vaccination, unsolicited AEs were reported by 26.7%–35.0% of the H7N1 recipients (none grade 3 vaccinerelated). Up to Day 42, MAEs were reported by 3.3%–15.0% of the H7N1-vaccinated subjects; 1 and 7 of all vaccinated subjects reported pIMDs and SAEs (none vaccine-related), respectively. Conclusions The AS03-adjuvanted H7N1 vaccines induced good immune responses to the vaccine-homologous and -heterologous (H7N9) strains, 21 days following the second dose in a population aged 65 years or older and was well-tolerated. Funding Biomedical Advanced Research and Development Authority (BARDA) and GlaxoSmithKline Biologicals SA TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P168 POSTE R A BSTRAC TS SPA6P08 Influenza A/H3N2 mutations causing vaccine mismatches and possibly associated with more severe disease, Singapore, 2009-2013 Lee, Hong Kai National University of Singapore, Singapore Introduction Recent studies have shown that amino acid (aa) substitutions, specifically those within influenza A/H3N2 HA1 epitopes A-E, particularly in A and B, result in antigenic drift. Such drift mutants may have reduced vaccine efficacy, resulting in more severe influenza-related illness in Europe, Canada and the USA during the Northern hemisphere 2012/13 influenza season. Methods Influenza A/H3N2 clinical samples were collected from the National University Hospital and Singapore General Hospital during April 2009- November 2013 (n=214). Patients were clinically stratified into groups with mild, moderate and severe influenza-like illness (ILI), in whom chronic pulmonary (including asthma), cardiovascular, renal, hepatic, neurological, hematologic, and metabolic disorders (including diabetes mellitus), immunosuppression or pregnancy, were considered relevant comorbidities. Full-genome A/H3N2 sequences, obtained directly from clinical samples without culturing, were compared against contemporaneous seasonal influenza A/H3N2 vaccine sequences. Patients were stratified into 3 age groups for analysis (≤18, 19-64, ≥65 years). Dated, clinically-tagged (‘mild’, ‘moderate’ or ‘severe’) viral sequence data (n=206) were analysed phylogenetically to examine the pattern of clustering of each gene. Results Dated, aa-annotated, and clinically-tagged phylogenetic trees showed that A/H3N2 viruses mainly from subclade 3 have been causing more clinically severe disease since 2011, as compared to earlier years (2009 and 2010). During the study period, 20/214 (9%) severe, 33/214 (15%) moderate, and 161/214 (75%) mild ILI cases were identified. From multinomial logistic regression (adjusted for gender, age groups, and comorbidity), aa substitutions N145S, A198S, and V223I were found with significantly higher prevalence in the HA1 genes (n=206) of the subclade 3 viruses obtained from patients with moderate/severe ILIs (all with p<0.05). Significant mutations detected in other subclade 3 viral genes included (all with p<0.05): T613A (PB2, n=208); E4G, P8L, and H32R (PB1-F2, n=201); D396E, V668I, and N675K (PA, n=201); L81P and N402D (NA, n=211); E26K (NS1, n=205). On the other hand, truncated PB1-F2 in non-subclade 3 viruses was also found to be significantly associated with higher disease severity. The aa mismatch frequencies in the epitopes A+B (epAB, Spearman correlation coefficient=0.149, p=0.033, n=206) but not in the epitopes A-E (Spearman correlation coefficient=0.033, p=0.639, n=206) were positively correlated with moderate/severe ILIs. Multinomial logistic regression analysis on the combined effect of factors (i.e. gender, age groups, comorbidity, with total aa mismatches in epAB) on moderate/severe ILIs showed that comorbidity (p<0.0001) was a more significant contributing factor than age (p<0.01) and total aa mismatches at the epAB loci (p<0.05, OR 1.4) for moderate/severe ILIs. Conclusions Although pre-existing comorbidities contributed mostly to the moderate/severe ILIs caused by influenza A/H3N2 subclade 3 viruses, there was a small, possible contribution from aa mismatches. Further functional investigation of these viral mutations is required to confirm these clinical disease associations. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P169 POSTE R A BSTRAC TS SPB6: RISK MANAGEMENT AND MITIGATION SPB6P01 Identification of molecular determinants involved in Influenza A H5N1 virus survival in the environment Leclercq, India (1,2); Pariente, Kevin (1); Sawoo, Olivier (1,2); Feher, Maxence (1); Vandenbogaert, Mathias (1); Manuguerra, Jean-Claude (1) 1: Institut Pasteur, France; 2: Université Paris Diderot, France Background Influenza A viruses (IAVs) are a major cause of human infectious respiratory diseases and their transmission is dependent upon the environment. However, the role of environmental factors on IAV survival outside the host still raises many questions. Previous results from the laboratory showed that external viral structures, such as glycoproteins (Hemaglutinin HA and Neuraminidase NA) and the lipid bilayer, in direct contact with the environment are mostly involved in the loss of virus infectivity. Our study contributed to the understanding of the mechanism of influenza virus survival outside the host by identifying molecular determinants involved in the loss or maintenance of Influenza A viruses viability.Methods The evolution of influenza A quasi-species during virus survival in water was assessed by using two A(H5N1) strains submitted to a temperature of 35°C. Viral infectivity in water at 35°C was assessed over time by the TCID50 method. Analysis by RT-PCR targeting the HA, NA and M genes was performed during the course of kinetic, at the beginning of the kinetic (day 0) and at the end of the kinetic (day 45). RT-PCR products were analyzed by HTS (High-throughput sequencing) method. Eighteen different amplicons from day 0 and day 45 corresponding to 5 HA and 4 NA regions of 350 bp were sequenced using the 454 GsFLX technology from Roche Diagnostics. Results More than 100,000 sequences (5485 sequences in average per sample) were obtained, filtered then analyzed by a workflow based on the Galaxy framework that uses the BWA sequence alignment program. Quantification and detection of variants were assessed through an in-house SNP-caller program and visualized with IGV viewer (Integrative Genomics Viewer). Minor variants for HA and NA genes were detected over time and their relative abundance varied between day 0 and day 45. HA variants with a frequency over 0.1% were considered. Some of these variants showed significant difference frequency between D0 and D45. Relevant mutations were chosen and lentiviral pseudoparticles bearing mutated HA on their surface were generated. Survival kinetics with these mutated pseudoparticles in water at different temperatures and salinities are in progress. Conclusions Expected data could highlight specific residus thus giving clues to the identification of molecular determinants involved in Influenza A viruses viability outside the host. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P170 POSTE R A BSTRAC TS SPB6P02 Recommendations and policies for sick leave during seasonal and pandemic influenza in Europe Edwards, Christina Hansen (1); de Blasio, Birgitte Freiesleben (1,2); Tomba, Gianpaolo Scalia (3) 1: Norwegian Institute of Public Health, Norway; 2: Dept. of Biostatistics University of Oslo, Norway; 3: Dept. of Mathematics, University of Rome, “Tor Vergata”, Italy Background The European Centre for Disease Prevention and Control (ECDC) and other researchers have pointed out that there is insufficient research on the transmission dynamics of influenza to establish the effect of workplace interventions. During the 2009 H1N1p influenza pandemic, many European countries issued recommendations for sickness absence. In this study, we review and compare the recommendations and policies issued across Europe in conjunction with seasonal and pandemic influenza. Methods A web-based survey consisting of 21 questions was issued to health authorities in 31 European countries to assess policies and recommendations on sick leave during seasonal and pandemic influenza epidemics. The questions concerned whether recommendations were issued, what the recommendations were, the basis of knowledge upon which the recommendations were based and the purpose of the recommendations. Identical questions were asked for pandemic and seasonal influenza. In addition, the health authorities were questioned about general national sick leave policies and perceived attitudes to sick leave. Results Health authorities in 18 of the 31 countries replied to the survey. Only one country introduced recommendation or policies for sick leave during seasonal influenza. During the H1N1 2009 pandemic 9 (50%) of the 18 countries had issued national policies or recommendations for sick leave. The most common recommendations included: staying at home until fever cessation (67%) and staying at home for a specific number of days (5-10 days) following symptom onset (22%). In countries where policy changes were made in response to the pandemic, more liberal sick leave policies were introduced. Moreover, the general national sick leave policies also differed with respect to the number of days of sick leave permitted prior to seeking medical advice (0-14 days), and the amount of payment received during a short sick leave period of up to 10 days (0%-100%). The main purposes of issuing the recommendations and policies was to reduce transmission in the population, to raise awareness, and to protect sick individuals. The recommendations were based either on expert advice or on recommendations issued by other countries or by the WHO. Conclusions Among the countries involved in the study recommendations or policies for sick leave during influenza were only issued by one country during seasonal influenza, and by half the countries for pandemic influenza. Further research is needed to evaluate various sick leave recommendations and policies to effectively achieve the aim of reducing influenza transmission. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P171 POSTE R A BSTRAC TS SPB7: HOST FACTORS IN PATHOGENESIS SPB7P01 Emerging anti-influenza agents Kainov, Denis University of Helsinki, Finland Influenza A viruses cause flu epidemics and pandemics with serious consequences for public health and global economy. Different treatment and prevention options have been developed and applied with limited success. We found that host-directed small-molecules, saliphenylhalamid, obatoclax, gemcitabine, MK2206 and SNS-032 inhibit influenza A virus infection. Moreover, influenza A virus was unable to develop resistance to these host-directed agents, in contrast to commercialy available virus-directed drugs. Saliphenylhalamid and SNS-032 have high specificity and good pharmacological properties, which warrant further development of these agents as antiviral drugs. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P172 POSTE R A BSTRAC TS SPB7P02 The impact of school dismissal and vaccination on influenza transmission: an alternative to school closure Voirin, Nicolas (1); Payet, Cécile (1); Régis, Corinne (1); Barrat, Alain (2); Cattuto, Ciro (3); Pinton, Jean-François (4); Lina, Bruno (5); Vanhems, Philippe (1) 1: Service d’Hygiène, Epidémiologie et Prévention, Hôpital Edouard Herriot, HCL & Université de Lyon, Lyon, France; 2: CNRS, CPT, UMR 7332, Université Aix Marseille, Marseille & Université de Toulon, La Garde, France; 3: Data Science Lab, ISI Foundation, Torino, Italy; 4: Laboratoire de Physique de l’Ecole Normale Supérieure de Lyon, CNRS UMR 5672, Lyon, France; 5: Laboratoire de Virologie Est, CNR des virus influenza & VIRPATH EA4610 UCBL, France Context Given the important role of children and young adolescents in the community spread of pandemic influenza, mitigation strategies including school closures are always debated. These closures have considerable social and economic costs and alternatives need to be proposed, including vaccination.Aims Using detailed contact data within a school and mathematical modelling, we wanted to test the impact of school cases dismissal in combination or not with vaccination as alternative interventions to school closure. Methods We used a stochastic, individual-based model in discrete time with time-steps of 20 seconds. In this model, at each time-step, each children and teacher can be S (Susceptible), V (Vaccinated), E (Exposed), I (Infected and symptomatic), A (infected and Asymptomatic), D (Detected) or R (Recovered). Construction of the model was based on the French academic year and typical school days and weeks. To model transmission, we made explicit use of detailed contact data collected in a French primary school of 242 individuals (232 children and 10 teachers). The dynamic contacts network was used for calculations. We modelled the transmission probability according to attack rates similar to those observed in school outbreaks. Parents dismiss their children (i.e. do not allow them to go to school) when they had symptoms for more than 12 hours before going to school with a 60% efficacy. Seven scenarios for influenza vaccination were explored as well as 21 scenarios combining vaccination strategies and detection/isolation. For each scenario 200 simulations were performed Results In the reference scenario the number of cases was 134 corresponding to an attack rate (AR) of 55% (134/242). In this reference scenario, 21%, 60% and 19% of cases occurred during the pre-epidemic, epidemic and post- epidemic periods respectively, and 90% of cases resulted from within school transmission. When no detection is practiced in the school, the number of cases range from 134 (AR, 55%) to 39 (AR, 16%) and the reduction range from -21% (28 cases prevented) to -71% (95 cases prevented) when vaccination is introduced. When detection took place three time a day, reduction range from -55% (73 cases prevented), in the absence of vaccination compared to -88% (118 cases prevented) in the best vaccine scenario. Conclusions This study confirms that alternative strategies to school closure can be used to mitigate dissemination of an influenza virus in primary schools. Results indicate that vaccination can be an interesting prevention measure when cases detection and isolation is insufficient. In absence of detection, 25% vaccination coverage leads to a 34% of attack rate reduction and 50% coverage to a 71% reduction. Combining with intermediate cases detection and isolation, these figures are 64% and 84% reduction respectively. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P173 POSTE R A BSTRAC TS SPB7P03 Understanding reasons behind HCW participation and non-participation in seasonal influenza vaccination in Podgorica, Montenegro to tailor strategies that increase uptake. Likhite, Nathalie Kavita (1); Kavaric, Nebosja (2); Grbovic, Mensud (3); Terzic, Natasa (4); Brajovic, Mina (5); Jorgensen, Pernille (1); Caroline, Brown (6) 1: World Health Organization Regional Office for Europe, France; 2: Primary Health Care Centre Podgorica; 3: Ministry of Health Montenegro; 4: Institute of Public Health Montenegro; 5: WHO Montenegro Country Office; 6: World Health Organization Regional Office for Europe, Copenhagen Background While seasonal influenza vaccination of health care workers (HCWs) is recommended in most European countries, vaccination uptake remains low. The WHO Regional Office for Europe tested an innovative approach – the Guide to Tailoring Immunization Programmes – with the Ministry of Health and Primary Health Care Centre (PHC) - Podgorica in Montenegro to design evidence-based solutions to increase uptake of seasonal influenza vaccination among HCWs. Formative research was conducted to explore and describe Montenegrin HCWs’ perceptions, attitudes, beliefs and practices regarding seasonal influenza vaccination. Methods A self-administered questionnaire on risk perceptions of vaccine preventable diseases (VPD) and vaccination practices was distributed to 400 frontline HCWs – physicians, nurses, laboratory technicians and ambulance personnel - in the PHC Podgorica in December 2012. In addition, 23 semi-structured interviews exploring VPD risk perception, motivations and barriers to influenza vaccination and strategies to increase uptake were conducted with HCWs and their managers in January 2013. Multivariate statistical analysis was used to identify factors associated with being vaccinated using data from the questionnaires. Content was analyzed from interviews to understand behavioural patterns. Results A total of 291 (73%) HCWs completed the survey. PHC Podgorica HCWs generally share a positive attitude towards immunization. Nevertheless, although almost 90%of HCWs believe seasonal influenza is the disease they are most at risk of contracting at work and transmitting to their patients and family, only 19% of HCWs were vaccinated in the 2012/2013 season. Main reasons for not vaccinating are low perceived susceptibility and disease severity (53%). Twenty eight percent of non-vaccinating HCWs believe that they acquire immunity against seasonal influenza through work. Having good health is another reason for non- vaccination. The only factor significantly associated with influenza vaccination was increasing age. Profession, education, years of experience or general attitude towards vaccination were not associated with vaccination status. Self protection is the most important reason for vaccination among vaccinating HCWs (40%), followed by patient and family protection, fear of flu and have had flu in the past. Mandatory vaccination, a supportive environment and improved communications emphasizing facts and negative effects of seasonal flu are cited as effective strategies to increase uptake. Conclusions Seasonal influenza vaccination among HCWs is a matter of personal choice. Most PHC Podgorica HCWs perceive seasonal influenza as a threat for risk groups, such as elderly, chronic disease patients or pregnant women. Though HCWs are a priority target group for seasonal influenza vaccination, and despite evidence of nosocomial infection in health care institutions and higher absenteeism, more tailored efforts are needed to emphasize vaccination benefits and counter misconceptions for HCWs to adopt seasonal influenza vaccination as a positive professional practice, with the objective of preventing nosocomial transmission of influenza and ensuring higher quality patient safety and care. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P174 POSTE R A BSTRAC TS PL05: LATE BREAKERS PL05P01 Pre-existing neutralizing antibodies against potential pandemic influenza viruses in middle-aged adults vaccinated annually with seasonal influenza vaccines Wei Wang, Esmeralda Alvarado, Qiong Chen, Dorothy Scott, Russell Vassell, and Carol D. Weiss Center for Biologics Evaluation and Research, US Food and Drug Administration, 29 Lincoln Drive, Bethesda, MD 20892 Background Emergence of potential pandemic influenza A viruses raised questions about whether immunization with prior influenza vaccines could confer any protection. We investigated whether persons immunized with recent seasonal influenza vaccines harbor neutralizing antibodies to potential pandemic influenza viruses. Methods Sera from 50 volunteers aged 48-73 years, who received all annual seasonal influenza vaccinations from 20002001 to 2008-2009 seasons, were collected in September-December of 2009. Sera were assessed for neutralizing antibody titers > 1:80 against H9, H7, H6, H5 and H3N2v subtype influenza viruses using an HA-pseudovirus neutralization assay. Results We found that 77% have titers against HK/1073/99 (H9N2), 30% have titers against HK/G9/97 (H9N2), 17% have titers against SE/81/02 (H6N1), 60% have titers against HK/SF4/01 (H6N1), 72% have titers against VN/1203/04 (H5N1), 44% have titers against EG/2321/07 (H5N1), 4% have titers against IND/5/05 (H5N1), 2% have titers against VN/NCVD-016/08 (H5N1), 75% have titers against IN/08/11 (H3N2v ), while none had titers against GY/337/06 (H5N1), SH/2/13 (H7N9) and NL/219/03 (H7N7). The neutralization titers to H9, H6 and H5 correlated well with each other, but not with H3N2v. However, within subtypes, the sensitivities of influenza virus strains to sera cross-neutralization varied. Conclusions These findings suggest that annual vaccination with seasonal influenza vaccines, especially multiple year vaccinations, can elicit cross-neutralizing antibodies to potential pandemic influenza viruses that may potentially contribute to protection. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P175 POSTE R A BSTRAC TS PL05P02 Clinical Safety and Efficacy of MHAA4549A, A Novel Monoclonal Antibody for the Treatment of Severe Influenza A: Results of a Randomized, Double-Blind, Placebo Controlled Clinical Trial Jorge Tavel, Jacqueline McBride, Rong Deng, Michael Derby, Tracy Burgess, Ning Chai, Summer Park, Min Xu and Lee Swem Genentech, South San Francisco, CA 94080 Background Novel therapeutics to treat severe influenza are a high unmet medical need. MHAA4549A is a human monoclonal IgG1 antibody against influenza A virus that binds to a highly conserved epitope on the influenza A hemagglutinin (HA) stalk region and allows broad neutralization of the influenza A virus. Preclinical data demonstrate a significant Clinical Safety and Efficacy of MHAA4549A, A Novel Monoclonal Antibody for the response lethalInfluenza challenge model mice and ferrets in both group 1 (H1N1, H5N1) and Treatmentto of aSevere A: Results of in a Randomized, Double-Blind, Placebo Controlled Clinical Trial group 2 (H3N2) strains of influenza A, including strong efficacy when dosed as late as 72 Jorge post-viral Tavel, Jacqueline McBride, Rong Deng, Michael Derby, Tracy Burgess, Ning Chai, hours challenge. Based upon these findings, a clinical trial was executed to Summer Park, Min Xu and Lee Swem study the safety and efficacy MHAA4549A in an influenza challenge model. Genentech, South San Francisco, CAof 94080 Background: Novel therapeutics to treat severe influenza are a high unmet medical need. Methods MHAA4549A is a human monoclonal IgG1 antibody against influenza A virus that binds to a epitope on the influenza A hemagglutinin (HA) stalk region and allows Inhighly this conserved randomized, double-blind, placebo controlled clinical trial, one hundred broad neutralization of the influenza A virus. Preclinical data demonstrate a significant healthy weremodel nasally inoculated H3N2 Wisconsin Influenza A strain. responsevolunteers to a lethal challenge in mice and ferrets inwith both group 1 (H1N1, H5N1) and group 2 (H3N2) strains of influenza A, including strong efficacy when dosed as late as 72 Nasopharyngeal swabs were collected three times daily for viral load assessment. At 24 hours post-viral challenge. Based upon these findings, a clinical trial was executed to the safety and efficacy of MHAA4549A in an received influenza challenge model. tostudy 36 hours after inoculation, subjects a single intravenous infusion of MHAA4549A atrandomized, three doses – 400mg, 1200mg and 3600mg or placebo. Endpoints of Methods: In this double-blind, placebo controlled clinical trial, one – hundred healthy volunteers were reduction nasally inoculated with H3N2 Influenza A strain. the study included in qPCR viralWisconsin load area under the curve (AUC) and clinical Nasopharyngeal swabs were collected three times daily for viral load assessment. At 24 symptoms. Comparison of active anda single placebo armsinfusion was performed using non-parametric to 36 hours after inoculation, subjects received intravenous of MHAA4549A at three doses – 400mg, 1200mg and 3600mg – or placebo. Endpoints of Wilcoxon rank-sum test. the study included reduction in qPCR viral load area under the curve (AUC) and clinical symptoms. Comparison of active and placebo arms was performed using non-parametric Wilcoxon rank-sum test. Results Results:Nasopharyngeal Median Nasopharyngeal Viral AUC Median Viral AUC There were no infusion reactions, no discontinuations, and no SAEs related to the study drug. The most common drug related adverse event was elevated ALT and AST that did not occur at a rate greater than that observed in the placebo group. Conclusion TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P176 POSTE R A BSTRAC TS MHAA4549A is a potent anti-influenza monoclonal antibody, producing up to a 98% decrease (p=0.0051) in the AUC of nasopharyngeal viral shedding compared to controls, as well as a trend in decreased influenza symptoms. Clinical data also suggest that MHAA4549A is safe and well tolerated. Currently, a study is being planned to evaluate the safety and efficacy of MHAA4549A in hospitalized patients with severe influenza. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P177 POSTE R A BSTRAC TS PL05P03 Ferret models to study clinical intervention strategies against influenza. Stittelaar, Koert (1); Mallett, Corey (2); de Waal, Leon (1); Veldhuis Kroeze, Edwin (1); van Amerongen, Geert (1); van den Brand, Judith (3); van der Vries, Erhard (3); Osterhaus, Ab (1,3) 1: Viroclinics Biosciences, Rotterdam, the Netherlands; 2: GlaxoSmithKline Biologicals, Laval, Québec, Canada; 3: Department of Viroscience, Erasmus MC, Rotterdam, the Netherlands Influenza is a moving target. Different influenza virus subtypes circulate across different avian and mammalian populations, drift, reassort, causing disease and spreading rapidly. Ferrets have proven to be indispensable for influenza virus research. Ferrets can be infected with primary and cultured human and avian influenza virus isolates and develop a disease pattern which is very similar to that in humans. Ferrets have shown to be instrumental over a broad spectrum of applications from the production of influenza-specific antiserum to the novel highly advanced immunocompromised model. The appropriateness of the different ferret models and their read out parameters for the assessment of clinical intervention strategies for influenza virus infection in humans, such as preventive vaccination and the use of antivirals are discussed in the context of high pathogenic avian influenza A/H5N1, pandemic influenza A/H1N1 and low pathogenic avian influenza A/H7N9 viruses TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P178 POSTE R A BSTRAC TS PL05P04 Results of phase II and phase III studies of AS03-adjuvanted cell culturebased H5N1 influenza vaccine (KD-295) Naruse, Takeshi; Tanabe, Tetsuro; Fukuda, Tadashi; Ichikawa, Munetaka; Oda, Yoshiaki; Tochihara, Shinji; Kino, Yoichiro The Chemo-Sero-Therapeutic Research Institute (Kaketsuken), Kumamoto, Japan Background KD-295, derived from A/Indonesia/5/2005 (H5N1) / PR8-IBCDC-RG2 strain cultured in duck embryonic stem cell-derived cell lines (EB66 ®), is a formulation mainly composed of HA protein obtained from inactivation and purification and to be mixed at the time of use with the AS03 adjuvant. Methods In order to determine the recommended clinical dose of KD-295, immunogenicity and safety were investigated in a double-blind, randomized, parallel-group study with 248 healthy adults (between 20 and 65 years of age). Subjects were distributed into four groups (MA, MB, HA and HB) with different volumes of adjuvant and antigen. Subjects received two 0.5 mL intramuscular administrations, with 21 day (± 7 day) intervals between administrations. To examine the safety and immunogenicity of KD-295 (MA agent), we conducted a multicenter, non-controlled, open-label study in 369 healthy adult subjects (between 20 and 65 years of age). Subjects received two 0.5 mL intramuscular administrations with 21 ± 7-day intervals between administrations. Results For immunogenicity, the MA agent group, HA agent group, MB agent group, and HB agent group all met all three evaluation criteria in the prototype vaccine guidelines after two administrations. However, higher antibody titer trends were observed in the HA agent group and the MA agent group, which were administered the standard volume of AS03 adjuvant, than in the HB agent group and the MB agent group, which were administered half the standard volume of AS03 adjuvant. In regards to safety, no adverse events causing death, serious adverse events, or adverse events requiring discontinuation of the study occurred. The HA agent group showed higher incidence of fever than the MA agent group. Based on these results, we selected the MA agent (3.8 .g HA + AS03 adjuvant standard amount) as the recommended clinical dose. Two administrations of the MA agent met all three evaluation criteria in the prototype vaccine guidelines. In addition, we confirmed antibody titers in some subjects three and six months after the second administration. Antibody titer decreased gradually, but antibody titers were retained even six months after the second administration. In regards to safety, no adverse events causing death, or adverse events requiring discontinuation of the study occurred. One case of potential immune-mediated disease and two cases of serious adverse events occurred, but a causal relationship was denied. Conclusion Based on the above, the formulation appeared to have an acceptable safety profile and the sufficient immunogenicity of this drug has been confirmed. Development of this agent was implemented as a pandemic influenza vaccine development and production preparation project, and production and marketing approval for indication as “prophylaxis for pandemic influenza (H5N1)” was granted in March 2014. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P179 POSTE R A BSTRAC TS PL05P05 Investigating the potential for temporary immunity between influenza viruses in the ferret model Laurie, Karen (1), Teagan Guarnaccia(1),(2), Louise Carolan(1), Ada Yan(3), Malet Aban(1), Patrick Reading(1), Anne Kelso(1), Jennifer Mosse (2), James McCaw(3),(4), Ian Barr(1) 1: WHO Collaborating Centre for Reference and Research on Influenza, VIDRL, Peter Doherty Institute for Infection and Immunity, Melbourne, Victoria, Australia; 2: Federation University Australia, School of Applied Sciences, Churchill, Victoria, Australia; 3: The University of Melbourne, Melbourne School of Population Health, Melbourne, Victoria, Australia; 4: Royal Children’s Hospital, Murdoch Childrens Research Institute, Vaccine and Immunisation Research Group, Melbourne, Victoria, Australia Background Epidemiological and modelling data suggest that following infection with influenza virus, there is a short period of time during which the host experiences lower susceptibility to infection with any strain of influenza or perhaps any respiratory virus. This phenomenon is independent of antigenic distance, and has been termed temporary immunity. In this study, we used the ferret model of human influenza to investigate the hypothesis of temporary immunity and the role it plays in determining the outcome of consecutive infections. Methods Ferrets were intranasally infected with a primary influenza virus then challenged 1 to 14 days later with a different influenza virus. Nasal washings were collected daily as representative samples of upper respiratory tract infection and the levels of virus shedding and immune markers measured. Primary infections were staggered to allow the challenge to be performed on all animals on the same day. Combinations of influenza A(H1N1)pdm09, A(H3N2) and influenza B viruses circulating in 2009 were tested to assess the potential for non-specific, as well as virus-specific, temporary immunity. Results Infection with A(H1N1)pdm09 virus could temporarily protect against subsequent challenge with influenza B virus, for short intervals. However a primary infection with influenza B virus did not protect against challenge with A(H1N1)pdm09 virus, rather co-infection or delayed secondary infections, were observed. Interestingly, primary infection with influenza B virus could block or delay subsequent challenge with A(H3N2) virus, yet A(H3N2) virus had no effect on subsequent infection with influenza B virus. Primary infection with A(H1N1)pdm09 virus blocked infection with A(H3N2); A(H3N2) virus and blocked A(H1N1)pdm09 virus challenge in some animals. Our results indicate that temporary immunity may be mediated by both innate and adaptive immune mechanisms (depending upon the virus pair and time interval), and studies to determine these mechanisms are ongoing. Conclusions These data support the hypothesis of temporary immunity. Infection with influenza A virus can prevent infection with an unrelated influenza B virus and vice versa, yet this occurrence is entirely dependent on the combination of viruses and the timing between primary infection and subsequent challenge. A hierarchy of the ability of infection with one influenza virus to block or delay infection with another is suggested. Co-infection with influenza A viruses and B viruses can occur in ferrets but only within a narrow period between challenges. Overall, these data indicate prior infection with an influenza virus can not only protect against antigenically similar viruses, but also against unrelated viruses. The impact of temporary immunity at a population level requires further investigation. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P180 POSTE R A BSTRAC TS PL05P06 Cost-effectiveness analysis of quadrivalent influenza vaccination in the elderly: an update of a united kingdom analysis Meier, Geneviève; Gregg, Meghann Health Economics, GlaxoSmithKline Vaccines, Wavre, Belgium Background The quadrivalent influenza vaccine (QIV), Fluarix Tetra®, has recently been made available in the United Kingdom (UK). This analysis describes an update of a previously published cost-effectiveness evaluation of Fluarix Tetra®. However, the present analysis considers only persons of 65 years old and older, as all persons in this age category are strongly recommended to be vaccinated. This evaluation also applies the updated guidelines for cost-effectiveness analyses from the JCVI (Joint Committee on Vaccination and Immunisation) and uses data from two recently completed burden of disease and costing studies in the UK that were not available at the time of the original publication. Methods: A recently published lifetime, multi-cohort, static Markov model that compares QIV to TIV (trivalent influenza vaccine) was used and updated with the most recent circulation data. In addition, the pandemic season 2009/2010 was excluded (as a seasonal influenza vaccine should not have been included during this period),current guidelines were applied, and the reference year for costs in the model was updated to 2013/2014. Results from two database analysis which included recent information not available at the time of original publication were also included in this update; the first one used the CPRD (Clinical Practice Research Datalink) with respect to mortality and cases by influenza type A and B viruses. The second study included used the CPRD HES-linked database (Hospital Episode Statistics) and examined the cost of influenza-related illness in the UK. The model perspective is that of the NHS (National Health Service) and the robustness of the model outcomes were asses using a probabilistic sensitivity analysis (PSA). Results The model projects that using quadrivalent influenza vaccination instead of trivalent vaccines in persons of 65 years old and older, averted on average per year 13,908 cases, 2,760 physician visits, 1,702 influenza-related complications, 462 hospitalisations and 238 deaths. Over the period of the model (life-time) using the current price of Fluarix Tetra® £9.94 versus the weighted average price of trivalent influenza vaccines (£6.43, Prescription Cost Analysis England 2013), the incremental cost-effectiveness ratio (ICER) was £13,523/QALY gained (Quality Adjusted Life Year). An analysis of the season 2005/2006 (highest level of mismatch for influenza B with highest circulation of influenza B) predicted a substantial increase in the number of avert clinical outcomes with 70,577 cases, 14,008 physician visits, 8,636 influenza-related complications, 2,343 hospitalisations and 1,208 deaths being averted had QIV been available at the time. Sensitivity analyses confirmed the robustness of the results. Conclusions In the UK context, the use of quadrivalent influenza vaccination with Fluarix Tetra® instead of trivalent influenza vaccines in persons 65 years and older is likely to be a cost-effective intervention. Fluarix Tetra® is a registered trademark of the GlaxoSmithKline group of companies. Conflict of interest G Meier and M Gregg are employees of GlaxoSmithKline group of companies. G Meier holds stock or stock options or restricted shares in the GlaxoSmithKline group of companies. Source of funding GlaxoSmithKline Biologicals SA Wavre, Belgium, funded this study and all costs related to the development of the abstract and poster presentation. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P181 POSTE R A BSTRAC TS PL05P07 Design of randomized, double-blind, controlled, multi-center phase IIb trials as part of the EU-funded UNISEC project to assess the safety, immunogenicity and clinical efficacy of cross-seasonal universal influenza vaccines with or without pandemic influenza vaccine in healthy adults. Liu, Marcy Heng (1); Robinson, Stuart (2); Ben-Yedidia, Tamar (3); Wanderley, Wilson Caparros (2); Pleguezuelos, Olga (2); Gottlieb, Tanya (3); Babecoff, Ron (3); Schmidt, Ed (4); Huckriede, Anke (5); Van Doorn, Eva (1); Hak, Eelko (1) 1: Department of PharmacoEpidemiology and PharmacoEconomics, University Center of Pharmacy, University of Groningen, Groningen, The Netherlands; 2: SEEK, United Kingdom; 3: BiondVax Pharmaceuticals, Israel; 4: Department of Pharmaceutical Technology and Biopharmacy, University Center of Pharmacy, University of Groningen, Groningen, The Netherlands; 5: Department of Medical Microbiology, Molecular Virology Section, University Medical Center Groningen, University of Groningen, Groningen, The Netherlands Background Current seasonal influenza vaccines mainly induce immune responses against viral membrane glycoproteins. These proteins, however, undergo continuous mutations by antigenic drift. To prevent immune escape, annual vaccination with the latest predicted viral strains is adopted. Such vaccination strategy not only poses inconvenience and costinefficiency, but also results in poor protective effectiveness when the vaccine strains are mismatched with the actual circulating strains. The latter point is especially of concern during a pandemic outbreak caused by antigenic shift, when a large geographical area is affected and the general population is naïve to the newly re-assorted viral strain. Aim As part of the EU-funded Universal vaccines Secured (UNISEC) project (http:// www.unisec consortium.eu), we aim to design phase IIb studies to evaluate the safety, immunogenicity and cross-seasonal clinical efficacy of two universal influenza vaccines targeting different conserved immunogenic regions of influenza A and B viruses. FLU-v and M-001 are both peptide based vaccines containing epitopes identified from the viral internal (structural) proteins. M-001 contains also epitopes from the viral surface glycoproteins. While FLU-v is composed of synthetic polypeptides, M-001 is composed of a single recombinant protein. Methods In two separate trials, a total of 1500 healthy adult study participants will be recruited from multiple centers in Europe and randomized to receive placebo or the tested influenza vaccines at low or high antigen doses through a double-blind procedure. Two parenteral administrations will be given with a 21 day interval. In one trial, additional administrations of pandemic influenza vaccine will also be given 21 and 42 days after the second administration, aiming to show enhanced response to pandemic influenza strains. Clinical symptom scores and adverse events (AEs) will be collected throughout the whole study period. Immune correlates of protection will be assessed 21 days after the second administration and after each pandemic vaccine administration. The (severity of) incident RT-PCRconfirmed influenza A and/or B infection will be recorded over two subsequent influenza seasons. This, together with clinical symptom score will decide clinical efficacy of the tested vaccines. Conclusion Universal influenza vaccines are urgently needed to increase protection among vulnerable groups. Vaccine trial design needs to incorporate safety, correlates of protection and clinical efficacy TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P182 POSTE R A BSTRAC TS PL05P08 Effectiveness of inactivated influenza vaccine in children less than 3 years of age over multiple influenza seasons Chang, Chia-Kun (1); Tsuei, Hsiang (2); Chih, Yi-Chien (1); Lee, Chia-Lin (1); Chou, Shu-Mei (1); Yang, Chih-Hui (1) 1: Division of Preparedness and Emerging Infectious Diseases, Centers for Disease Control, Taipei, Taiwan, Republic of China; 2: Center for Drug Evaluation, Taipei, Taiwan, Republic of China Objectives Preschool children are at increased risk for severe complications from influenza, but studies about influenza vaccine effectiveness (VE) are rare. Taiwan launched a free influenza vaccination program for children aged 6 to 24 months in 2004, and expanded to children aged less than 36 months in 2008 according to Advisory Committee on Immunization Practices. This study aims to assess trivalent inactivated influenza vaccine (TIV) effectiveness among children aged 6 to 36 months over 7 consecutive influenza seasons in 2004-2010. Methods We conducted a nationwide retrospective-cohort study by using National Health Insurance Research Database (NHIRD) and National Immunization Information System database (NIISD) in Taiwan. Study population was children aged 6 to 36 months. The information of influenza vaccination status was obtained from NIISD, all enrollee were divided into three groups: non-vaccinated, partially-vaccinated (one dose only) and full-vaccinated (two doses). Study period was October to December per year (prior 3 months of flu season). The outcome of interest was medical utilization and cost because of influenza-like illness (ILI) and the information was retrieved from NHIRD by ICD-9 during 2004-2010 seasons. Student t-test and chi-square test were used to analyze group differences and estimate Risk Ratio (RR). Logistic regression was used to model the association between influenza vaccination and medical utilization. Vaccine Effectiveness was calculated as (1-odds ration)*100. Results A total of 1,258,795 children were included during 2004-2010 in 7 seasons, full-vaccinated 644,063 (51.16%), partial vaccinated 143,234 (11.38%) and non-vaccinated 471,498 (37.46%). Compared to other two groups, fullvaccinated group had lowest frequency of hospitalization and emergency department (ED) visits (mean: 0.0070.010, p<.001). RR also showed decreased hospitalization and ED visits in full-vaccinated group. After adjusted age, gender and region, VE of full-vaccination were 4%-35% for hospitalization, 15%-45% for ED visits as compared to those not vaccinated. The average medical point for hospitalization in full-vaccination group was 97.0-131.8, which significantly saved 19%-45% and 43%-139% compared to non-vaccinated group and partially-vaccinated. For ED visits in full-vaccination group was 29.8-53.3 with saving 14%-82% and -12%-45%. For Outpatient in full-vaccination group was 288.1-536 with saving -26%-27% and -46%-6%. Conclusion This long-term retrospective cohort study found influenza vaccination can reduce the frequency and medical cost of hospitalization and ED visits , which demonstrates moderate protective effectiveness among preschool children. Keywords Influenza, vaccine effectiveness, cost-effectiveness, children, Taiwan TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P183 POSTE R A BSTRAC TS PL05P09 Self-adjuvanting influenza candidate vaccine carrying HA and M1 epitopes on a proteinaceous multivalent nanoplatform Szurgot, Inga (1); Szolajska, Ewa (1); Laurin, David (2); Lambrecht, Benedicte (3); Chroboczek, Jadwiga (1,2) 1: Institute of Biochemistry and Biophysics Polish Academy of Sciences, Poland; 2: TheREx, TIMC/IMAG, UMR CNRS/UJF 5525, Domaine de la Merci, 38700 La Tronche, France; 3: CERVA Veterinary and Agrochemical Research Centre, 1180 Brussels, Belgium Background The traditional influenza vaccines, based on the induction of neutralizing antibodies against the influenza surface glycoproteins have to be produced new every season to match the circulating viruses. It is thought that the vaccine that could elicit cross-reactive T cell-mediated immunity targeting conserved regions of viral proteins could confer broader protection across heterologous influenza strains. To meet these expectations we exploit the features of a virus-like particle, the adenoviral dodecahedron (Dd), for engineering a vaccine carrying both, hemagglutinin (HA) and the epitopes derived from highly conserved M1 matrix protein, for induction of neutralizing antibodies and, at the same time, of cross-reactive CTLs. Dd is a proteinaceous, biodegradable VLP, endowed with remarkable endocytosis activity. Two different M1 immunodominant epitopes were inserted in Dd external positions, whereas HA was attached to the vector surface by a fragment of adenovirus fiber protein which enables stable interaction with Dd. The vaccine is spontaneously formed upon expression in the highly flexible and safe baculovirus system, which allows for fast and cost-effective production. Methods In the first step the vaccine in a form of Dd bearing 60 M1 epitopes was constructed, expressed in the baculovirus system and purified. Its safety and immunogenicity was evaluated in vitro on human peripheral blood mononuclear cells (PBMC), and in vivo on specific pathogen-free (SPF) chickens. In the second step the complete vaccine containing both antigens was obtained and analyzed. Results The initial candidate vaccine containing immunodominant M1 epitopes strongly induced cell-mediated immunity both in vitro and in the animal model. In vitro tests showed that Dd carrying M1 epitopes is a potent activator of human myeloid dendritic cells (MDC). M1 peptides were efficiently presented in the context of HLA class II and crosspresented by the HLA class I molecules, activating both CD8+ memory T cells and CD4+ T cells that are known to support the generation and maintenance of CD8+ memory T cells. Importantly, upon chicken vaccination with DdM1 both cellular and humoral immune responses were elicited in the absence of an adjuvant. Our data show that the proposed vaccine is able to induce strong and possibly long-lasting cell-mediated immunity. The final vaccine containing cellular immunity eliciting M1 immunodominant epitopes as well as humoral immunity eliciting HA protein is at present prepared. Current work focuses on evaluation of immunogenicity of the complete vaccine (DdM1-HA) in the animal model. The molecular analysis of the final vaccine will be presented. Conclusions Development of a stable complex containing two different influenza antigenes on a multivalent presentation platform - dodecahedron, that serves as a vector and an adjuvant is an important step toward a novel, long-lasting influenza vaccine that could stimulate both humoral and cellular immunoresponses. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P184 POSTE R A BSTRAC TS PL05P10 Exploratory Study for Risk Group of Psychogenic Illness Following Vaccination: Experience from Mass Immunization Campaign Against Pandemic Influenza A (H1N1) 2009 in Republic of Korea Yang, Taeun; Park, Young-Joon; Kim, Hee Jung; Lee, Yeon Kyeong; Park, Ok Korea Centers for Disease Control and Prevention, Korea, Republic of (South Korea) Backgrounds Increased numbers of psychogenic illness cases following mass vaccination were reported during 2009-2010 influenza season in Korea. Objectives We aimed to investigate the characteristics of reported psychogenic illness cases following pandemic influenza mass vaccination that needed further interventions of National Immunization Program and to estimate the economic burden by identifying risk group, clinical course and medical cost. Methods We reviewed epidemiological features, clinical manifestations, management and medical cost from the reports of vaccine injury compensation among the cases who were finally concluded as psychogenic illness following 2009 pandemic influenza A (H1N1) vaccination by Korean Advisory Committee on Vaccine Injury Compensation. Results: During 2009-2010 influenza season, 13 million people were immunized against pandemic influenza. Of 28 psychogenic illness cases following immunization which claimed for compensation, 25 were vaccinated under school-located mass immunization. Significant numbers of the psychogenic illness following mass vaccination against pandemic influenza cases were female adolescents (68.0%) and had underlying emotional life-stressors (36.0%). Their utilization of healthcare produced long duration of hospitalization (mean: 8.1 days) and high cost (mean: USD $ 2,246 per case). Conclusions The female adolescents were high risk group of psychogenic illness following school-located mass immunization and the medical expenses from their illness were remarkable. Health authorities, immunization managers, organizers of future mass vaccination should be aware of and prepare psychogenic illness especially for those who are at risk to achieve immunization goal. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P185 POSTE R A BSTRAC TS PL05P11 Sensitivity, specificity and predictive values of clinical definitions of influenza Cohen Jean Marie 1, Gaston De Serres 2, Isabelle Daviaud1, Anne Mosnier 1, Tan Tai Bui 1, Vincent Enouf 3, Martine Valette 4, Michel Lamure 5 with the help of doctors and virologists in the GROG network. 1: Open Rome, Paris, France and GROG network, France; 2: University of Laval, Québec, Canada; 3: GMVR, Institut Pasteur, Paris, France; 4: Virology laboratory, University Claude Bernard Lyon 1, France; 5: Health, Individual, Society Laboratory, University Lyon 1, France Context. The choice of a very reliable definition may facilitate the development of flu surveillance devices directly involving the population, as is being experimented in the Netherlands and England, for example. Flu surveillance systems call on multiple clinical definitions of the disease. Since 1984, most flu surveillance networks have been based on a double surveillance, clinical and virological. Before an epidemic, their ability to alert is maximized by a clinical definition that is both sensitive (so as not to “miss the start of the epidemic”) and that has a strong negative predictive value (to avoid attributing an epidemic to the flu when in fact it is caused by another virus). The GROG network is a flu surveillance network in outpatient medicine, which since 2003 has collected nasopharyngeal specimens in patients with an acute respiratory clinical picture who are tested by culture and/or by a nucleic acid amplification (RT-PCR) technique, which identifies cases of flu with sensitivity and specificity. Access to these virological data makes it possible to evaluate the performance of clinical definitions of flu currently used. Objective. To estimate the sensitivity (SE), specificity (SP) and positive predictive values (PPV) and negative predictive values (NPV) of the most commonly used clinical definitions of flu. Methods Inclusion period: France, for 9 consecutive seasons of flu surveillance, from September 29th, 2003, to May 23rd, 2012. Study population: 46,879 patients attending general practice or pediatrics for acute respiratory infection, having undergone a nasopharyngeal swab along with a clinical file describing the clinical symptoms presented by the patient.The virological result was positive for the flu in 13,819 of them. Definitions tested: ILI (influenza-like infection, ECDC, WHO, US CDC), ARI (acute respiratory infection, ECDC/WHO Europe, GROG), FS39 (febrile ILI at 39° C and higher, INSERM). Reference method: positive virological response to flu virus A or B after analysis of the sample by culture on MDCK cells and/or by RT-PCR of the nasopharyngeal sample. Epidemic periods: predictive values depending on the prevalence of infection, 3 periods, pre-, peri- and post-epidemic were considered. The epidemic period is defined as all the weeks around the epidemic peak and covering 85% of positive samples for the flu. Results The most sensitive definitions in each period are those of the US CDC (ILI), the ECDC (ARI) and the GROG network (ARI). Compared to these definitions, the ILI-WHO underestimates the frequency of flu by about 25% while the definition limited to very febrile forms (39° C and above) has a higher specificity than other definitions, but its sensitivity is so low that it detects 3-4 times fewer cases than the others. In the pre-epidemic period, all definitions have a very low PPV (<13%) and high VPN (93.8% -96%). TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P186 POSTE R A BSTRAC TS Pre-epidemic ARI_GROG ILI_ECDC ARI _ECDC ILI_WHO ILI_US CDC FS39_Inserm SE 85.9 82.4 86.2 65.7 90.5 21.9 SP 26.3 32.6 25.2 55.9 20.4 88.3 VPP 8.0 8.4 7.9 10.0 7.9 12.3 VPN 96.1 96.1 96.0 95.6 96.6 93.8 In the epidemic period, all clinical definitions have a similar PPV varying between 46.8% and 56%. Similarly, the VPN are similar, ranging from 58% to 71%. Peri-epidemic ARI_GROG ILI_ECDC ARI _ECDC ILI_WHO ILI_US CDC FS39_Inserm SE 84.3 80.3 84.4 61.5 89.9 19.3 SP 24.9 30.2 24.1 53.6 19.4 88.0 VPP 47.1 47.7 46.8 51.2 46.9 56.0 VPN 66.8 66.0 66.2 63.7 70.9 58.0 In the post-epidemic period, the VPPs are low but higher than in the pre-epidemic period while the VPNs remain at high levels but lower than the VPNs in the pre-epidemic period. Post-epidemic ARI_GROG ILI_ECDC ARI _ECDC ILI_WHO ILI_US CDC FS39_Inserm SE 82.1 78.6 82.0 60.6 90.6 21.1 SP 26.5 31.9 25.7 55.2 20.6 89.2 VPP 17.2 17.7 17.0 20.1 17.5 26.6 VPN 88.9 88.9 88.5 88.3 92.2 85.9 Conclusion The clinical definitions US CDC (ILI), ECDC (IRA and ILI) and GROG (ARI) have similar and reliable performances. The low sensitivity of the definition FS39 (febrile flu syndrome at 39° C and higher), due to a desire to gain specificity, underestimates the burden of influenza by 3 to 4 times compared with other definitions. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P187 POSTE R A BSTRAC TS PL05P12 Efficacy of chicken immunization against H5N1 influenza virus with bacterially produced hemagglutinin protein. Saczynska, Violetta (1); Romanik, Agnieszka (1); Florys, Katarzyna (1); Cecuda-Adamczewska, Violetta (1); Kęsik-Brodacka, Małgorzata (1); Łukasiewicz, Natalia (1); Sokołowska, Iwona (1); Minta, Zenon (2); Smietanka, Krzysztof (2); Szewczyk, Bogusław (3); Płucienniczak, Grazyna (1); Płucienniczak, Andrzej (1) 1: Institute of Biotechnology and Antibiotics, Poland; 2: National Veterinary Research Institute, Poland; 3: Intercollegiate Faculty of Biotechnology of University of Gdansk, Poland The highly pathogenic avian influenza virus (HPAIV) H5N1 causes multi-organ disease and death in birds as well as poses a permanent pandemic threat. Therefore, the development of efficacious vaccines against H5N1 HPAIV is of both veterinary and public health significance. Moreover, the demand for technology that would allow the efficient production of such a vaccine in a relatively short time, contrary to the traditional egg- or cell culture-based manufacturing, is widely recognized. Our research was performed with the use of relative ease, low-cost and efficient bacterial expression system for the subunit vaccine production. Hemagglutinin (HA) - an immunodominant antigen of influenza viruses, has been chosen as the target antigen since it is capable of elicit neutralizing antibodies, both during infection and vaccination. The H5 HA protein, based on the sequence of A/swan/Poland/305-135V08/2006(H5N1) virus was expressed in Escherichia coli in the form of inclusion bodies. Refolded and purified antigen was examined for vaccination efficacy in the layer-type chicken model. The immunization was performed twice at six-week interval by subcutaneous injection of 5, 10, 15 or 25 mcg of rH5 HA per dose with alhydrogel as an adjuvant. To evaluate humoral immune response, serum samples were collected at different time points of experiment and analyzed for the presence of anti-H5 HA antibodies by indirect ELISA, competitive ELISA (FLUAcH5, IDVet) and hemagglutination inhibition (HI) test with heterologous H5N2 low pathogenic AIV. It was shown that two doses of rH5 HA are necessary but sufficient to induce robust immune response in all immunized chickens. The endpoint titers of anti-H5 IgY antibodies were as high as ~ 330 000, on the average. Moreover, 60 - 90% birds immunized at applied dosage regimens were positive in FLUAc H5 test. Importantly, protective HI antibody titers (≥ 1:16) were found in 100% and 80% of chickens immunized at 10 - 25 mcg and 5 mcg per dose, respectively, and HI-antibody titers reached high values up to 1:512. Altogether, these results indicate potential of our H5 HA-based, bacterially produced, vaccine candidate to confer protection against H5N1 AIV. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P188 POSTE R A BSTRAC TS PL05P13 Airway fluids from mice and ferret contain different innate immune proteins that mediate antiviral activity against influenza A viruses Job, Emma (1,2); Short, Kirsty (2); Deng, Yi-Mo (3); Laurie, Karen (3); Brooks, Andrew (2); Saelens, Xavier (1); Reading, Patrick (2,3) 1: Inflammation Research Centre, VIB and UGent, Belgium; 2: Department of Microbiology and Immunology, Peter Doherty Institute, University of Melbourne; 3: World Health Organisation Collaborating Centre for Influenza, Peter Doherty Institute, Melbourne Soluble neutralizing inhibitors in airway fluids of humans and animals provide an effective first-line barrier to influenza A virus (IAV) infection. Ferrets and mice represent the most widely used animal models to study human IAV and immune responses to IAV infection have been particularly well characterized in the mouse model. Previous studies demonstrated that surfactant protein (SP)-D, a member of the collectin superfamily, is the major neutralizing inhibitor of IAV in the upper and lower respiratory tract of mice. However, little is known regarding the nature of soluble anti-IAV proteins in the ferret airways, nor whether these are similar to those in mice or in humans. Our recent work has demonstrated that soluble neutralizing inhibitors in the airways of ferrets differ markedly in their properties compared to those present in mice. We demonstrate that a SP-D-resistant mutant of A/Philippines/2/1982 was highly virulent in mice, but showed no difference in its ability to infect and replicate in ferret airways compared to wild-type virus. Although SP-D was detected in bronchoalveolar lavage fluids (BALF) from naïve ferrets, it was not the major neutralizing activity against H3N2 subtype viruses. Instead, one or more sialic acid α(2,6)-rich glycoproteins in the ferret airways were shown to act as potent inhibitors of H3N2 IAV. Mutants of H3 subtype resistant to the sialylated glycoprotein inhibitor in ferret BALF was characterized by a single amino acid substitution, L226Q, in the receptor-binding pocket of the HA. This mutation is typically associated with resistance to α(2,6) sialylated glycoproteins and results in a change in receptor preference from dual recognition of SAα(2,3) and SAα(2,6) to a sole recognition of SAα(2,3). Affinity chromatography and mass spectrometry techniques have identified 5 candidate glycoproteins which are currently being explored further. Together, these data indicate clear differences in the major neutralizing inhibitors in mouse and ferret BAL which are active against IAV. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P189 POSTE R A BSTRAC TS PL05P14 Diagnostic reassortant influenza strains for anti-neuraminidase antibody detection in clinical studies of live influenza vaccine Smolonogina, Tatiana; Desheva, Yulia; Donina, Svetlana; Rekstin, Andrey; Rudenko, Larisa Institute of Experimental Medicine, Russian Academy of Medical Sciences, Saint Petersburg, Russian Federation Background Both hemagglutinin (HA) and neuraminidase (NA) antigens contribute to protection against influenza illness. WHO-organized meetings repeatedly underlined the importance of improvement of methodology for NA-specific assays in order to evaluate different aspects of the immune response after influenza infection and vaccination. One of the problems is the specificity of neuraminidase inhibition (NI) assays, since antibodies that bind to HA can interfere with the interpretation of neuraminidase inhibition responses. The use of recombinant NAs can solve the problem, but it is difficult to obtain NA in active multimeric form. Alternatively, antigenic hybrid influenza strains with mismatched HA can be used as antigen. The aim of this study was to prepare a collection of well-characterized diagnostic reassortant influenza A strains comprising NA of epidemic, pandemic and potentially pandemic viruses for specific evaluation of quality of the anti-NA antibody response after influenza vaccination. Materials and methods Several diagnostic reassortant strains of A(H7N1) and A(H7N2) subtypes containing the NA of A/ Vietnam/1203/04(H5N1), A/California/07/09(H1N1), A/Leningrad/134/17/57(H2N2), A/California/1/66(H2N2) and A/Victoria/361/11(H3N2) influenza viruses were generated by classic genetic reassortment in embryonated chicken eggs. All reassortants comprised the HA of parent strain A/equine/Prague/1/56(H7N7). The peroxidaselinked lectin micro-procedure of NI assay previously reported by C.R. Lambre et al. was adjusted using these reassortants. NI antibodies as well as hemagglutination-inhibiting (HI) or neutralizing antibodies were measured in sera (390 samples) of volunteers who participated in clinical studies of live attenuated influenza vaccine candidates of potentially pandemic HA-subtypes: A/17/duck/Potsdam/86/92(H5N2), A/17/turkey/Turkey/05/133(H5N2) and A/17/California/66/395(H2N2). Results A panel of high-yield reassortant strains with NA of a variety of influenza A viruses and A/Leningrad/134/17/57(H2N2) or A/Puerto Rico/8/34(H1N1) backbone was generated. Equine HA inherited by reassortant strains had low (40-47%) amino acid sequence identity with HA of current epidemic and potentially pandemic strains (H5 or H2 subtypes) and didn’t cross-react in HI assay with rat or human anti-sera to these influenza A viruses. Strong correlation (Rs=0.75 (95%CI: 0.66-0.79); n=44; p<0.0001) between anti-NA antibody titers obtained in NI assay using either whole reassortant virus or recombinant multimeric NA suggests that the data obtained using diagnostic H7 strains were reliable. NI assay revealed ≥2-fold increase of anti-NA antibody in sera of 13.8-48.1% of volunteers after two vaccine doses. Coincidence of antibody titer increase in NI assay and microneutralization/HI test in the same pairs of sera of vaccinated subjects ranged between 55.6% and 73.2% depending on the vaccine strain. 3.4-29.6% of vaccinated volunteers developed anti-NA antibody response in the absence of increase in HI or neutralizing antibody titers. Conclusions The NI assay with diagnostic reassortant H7 strain as antigen specifically revealed serum anti-NA antibodies. Our data suggest that the NI test may serve as an informative addition to the traditional serologic assays providing more comprehensive evaluation of influenza vaccine immunogenicity. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P190 POSTE R A BSTRAC TS PL05P15 MUC1 enhances influenza binding and infection of epithelial cells Allen, Robert John; Brown, Lorena Elizabeth; McAuley, Julie Louise The University of Melbourne, VIC, Australia Background Influenza A virus (IAV) haemagglutinin (HA) is known to interact with sialic acid (SA)- containing receptors to facilitate viral entry to a host cell. However, the identity of the receptor molecule(s) that trigger endocytosis upon virus binding remains unknown. Large sialylated glycoproteins on epithelial cells may potentially function either to protect against or facilitate influenza infection. Herein, the cell-surface mucin MUC1 has been investigated for its role in IAV infection. Methods Chinese hamster ovary K-1 (CHO) cells engineered to express human MUC1 (CHOMUC1+) were used alongside unmodified CHO cells (CHO-Parent) in influenza infection experiments. These cells were either untreated or pretreated with bacterial neuraminidase to remove terminal SA structures in order to confirm SA-dependence of virion attachment and entry. Cells were infected with A/Udorn/307/72 (H3N2) virus at a multiplicity of infection of 10 and harvested 1 or 8 hours later. Cells were analysed by flow cytometry and confocal microscopy to evaluate the percentage of cells with virions attached by detection of HA (1hpi) and the amount of viral nucleoprotein (NP) produced within the first round of replication (8hpi). Results Flow cytometric data on cells at 1hpi showed that a significantly greater percentage of CHO-MUC1+ cells are HA+ compared to CHO-Parent cells (87 vs 58%, p < 0.001; unpaired t test). Additionally, analysis of infected cell monolayers by confocal microscopy demonstrated that significantly greater numbers of fluorescent pixels representing HA staining were present on the surface of CHO-MUC1+ cells compared to CHO-Parent cells (HA pixels/nucleus 0.76 vs 0.45, p < 0.001; unpaired t test). In addition, HA staining co-localised with MUC1 staining on 89% of occasions, indicating a possible close association. At 8hpi, a significantly higher proportion of CHO-MUC1+ cells were viral NP+, compared to CHO-Parent cells (76 vs 48%, p < 0.001; unpaired t test). These interactions are dependent on the presence of SA at the cell surface as all neuraminidase-treated cells had minimal levels of viral HA bound to the cell, regardless of MUC1 expression. Conclusions The presence of MUC1 at the cell-surface of epithelial cells appears to enhance viral attachment and infection of cells, at least in vitro. The interaction of virus with MUC1 was supported by co-localisation studies and was dependent upon the presence of sialic acid. These data implicate MUC1 as a binding and entry receptor molecule for influenza on epithelial cells. Knowledge of cell-surface receptors for influenza A virus may enhance research into receptor-mediated viral endocytosis and provide a potential therapeutic target. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P191 POSTE R A BSTRAC TS PL05P16 Use of government-funded antiviral drugs for containment of an influenza A(H1N1) pdm09 outbreak in a long-term care psychiatric facility, 2014 Lin, Mei-Ling (1); Teng, Ya-Wen (2); Chih, Yi-Chien (1); Chang, Chia-Kun (1); Chou, Shu-Mei (1); Yang, Chih-Hui (1) 1: Division of Preparedness and Emerging Infectious Diseases, Centers for Disease Control, Taipei, Taiwan, Republic of China; 2: Eastern Regional Center, Centers for Disease Control, Taipei, Taiwan, Republic of China Objectives During seasonal influenza epidemics, outbreaks of influenza in closed institutions are common and such outbreaks might be associated with high morbidity, even with serious mortality. To effectively control seasonal influenza outbreaks in long-term care facilities, the Taiwan Centers for Disease Control (Taiwan CDC) has released and distributed stockpiled antiviral drugs (oseltamivir and zanamivir) for residents and health care providers as treatment and chemoprophylaxis during flu season since 2011. From April 13 through May 4, 2014, eight clusters of influenza-like illness (ILI) with influenza A(H1N1)pdm09 occurred in different psychiatric wards of the same facility. We report the efficacy of chemoprophylaxis with antiviral drugs to control outbreaks in semiclosed environments. Materials and Methods There were 2,595 residents and 667 staff members in the facility with 10 wards, the seasonal influenza vaccination coverage rate were 94.7% and 94.9% respectively. All personnel with suspected infection were tested, treated with antiviral drugs and clinically isolated. In addition, we administered postexposure chemoprophylaxis with antiviral drugs to all residents and staff members in six of the eight affected wards, including one acute ward. The intervention dates varied across the six wards. Other preventative measures, including case isolation, personal hygiene, wearing proper personal protective equipment, and intensive daily health surveillance, were implemented during the outbreak period. Results A total of 829 personnel were at risk across the six affected wards, with 641 receiving chemoprophylaxis. There were 174 ILI cases (174/228=76%, 228: total ILI cases) detected in the six wards during the investigation period with a mean attack rate of 21% (174/829). The mean attack rate for the other two wards without chemoprophylaxis intervention was 11.1% (54/488) A total of 21 nasopharyngeal swabs specimen were tested with 12 positive for influenza A(H1N1)pdm09. A total of 151 personnel (86.8%) were infected before the intervention, and 23 (13.2%) after the intervention. There was a significant reduction in the overall attack rate, from 18.2% (151/829) before the intervention to 2.8% (23/829) after the intervention. Furthermore, the attack rates dropped obviously in five chronic/ mild wards with declining about 74-100% after chemoprophylaxis intervention, and the attack rate in the acute ward declined 57% after the intervention. Conclusion Although the clusters were not reported in real-time which caused the delay of chemoprophylaxis and underestimation, the study still found antiviral chemoprophylaxis together with early identification and isolation of infected personnel, was effective in reducing the impact of outbreaks of influenza in closed facility. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P192 POSTE R A BSTRAC TS PL05P17 Circular DNAzyme against the BM2 gene transcript of influenza B virus: a potent inhibitor of virus replication in host cells Kumar, Binod; Rajput, Roopali; Kumar, Prashant; Khanna, Madhu Department of Respiratory Virology, Vallabhbhai Patel Chest Institute, University of Delhi, India Background The influenza B virus BM2 ion channel protein is highly conserved and essentially required during the trafficking, assembly and budding processes of virus, thus an attractive target for designing antiviral drugs. Although single stranded DNAzymes (Dz’s) may represent the most effective nucleic acid drug to date, they are nevertheless sensitive to nuclease degradation and require modifications for in vivo application. The previously used PTO modifications have been shown to reduce the catalytic efficiency and are toxic when applied in vivo. Methods We designed several 10-23 DNAzymes (Dz’s) targeting different regions of the matrix gene (BM2) of influenza B virus and analyzed their ability to specifically cleave the target RNA in both cell free systems as well as in cell culture using transient transfections. We further aimed to circularize the Dz to provide extended stability keeping the catalytic efficiency intact. Results RT-PCR and real-time RT-PCR assays showed significant 45% inhibition of BM2 gene of influenza B viruses upon specific Dz treatment. The transfection of MDCK cells with Dz showed reduced cytopathic effect caused by influenza B virus (B/Yamagata/K270/2001) and considerably reduced the BM2 protein expression for a comparatively longer duration of time. The catalytic efficiency of both linear and circular DNAzyme was found comparable. As expected, the mutant-Dz did not hinder in virus replication showing high level of specificity of designed Dz towards the target RNA. Conclusions Our results demonstrate substantial reduction in whole virus replication thereby paving new dimensions in antiviral therapy. Our study, for the first time, has documented antiviral potential of circular-Dz against BM2 transcript of influenza B virus. Thus, we propose that the 10-23 DNAzymes may be used as selective and effective inhibitor of viral RNA replication, and can be explored further for development of a potent therapeutic agent against influenza infection. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P193 POSTE R A BSTRAC TS PL05P18 The fraction of influenza virus infections that are asymptomatic: a systematic review and meta-analysis Leung, Nancy; Xu, Cuiling; Ip, Dennis; Cowling, Benjamin School of Public Health, Li Ka Shing Faculty of Medicine, The University of Hong Kong, Hong Kong Special Administrative Region, China.) Background Influenza virus infections lead to a wide range of clinical manifestations, from severe pneumonia through to subclinical or even asymptomatic disease. There has been substantial controversy over thproportion oinfluenza virus infections that are asymptomatic, referred to as the asymptomatic fraction (AF). Knowledge on the AF, variation in the AF in certain groups, and the potential infectiousness of asymptomatic cases is extremely important in designing public health control strategies sucas contact tracing and quarantine, and in estimating the burden of disease. Methods We conducted a systematic review to assess and summarize the AF of influenza virus infections. Influenza virus infections were confirmed by RT-PC oviral culture in respiratory specimens, while serologic evidence of recent influenza virus infection was indicated by a 4-fold or greater rise in antibody titer in paired sera or a high titer ia single post‐epidemic serum specimen. The AF is defined as the proportion of individuals with influenza virus infection that experienced no symptomatic illness. Results We found that estimates of the AF were reported from two different types of studies: first, outbreak investigations with short-term followup of potentially exposed persons and virologic confirmation of infections; second, studies conducted across epidemics typically evaluating rates of acute respiratory illness among persons with serologic evidence of infection, in some cases adjusting for background rates of illness from other causes. Most point estimates from studies of the first type fell ithe range 8%-28%. Estimates from the second type of study without adjustment were very heterogeneous (point estimates 0%-93%; I2=97%), while estimates from studies that adjusted for the rate of background illnesses were more consistent with point estimates in the range 65%-85%. Conclusions Variation in estimates could be partially explained by differences in study design and analysis, and inclusion of mild symptomatic illnesses as asymptomatic in some studies. Considerable differences between the AF of infections confirmed by virologic versus serologic testing may indicate fundamental differences in the interpretation of these two indicators. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P194 POSTE R A BSTRAC TS PL05P19 Expression, purification and immunological properties of glycosylated influenza H5N1 hemagglutinin produced in Pichia pastoris Kopera, Edyta; Zagórski-Ostoja, Włodzimierz; Grzelak, Krystyna; Protas-Klukowska, Anna Maria; Zdanowski, Konrad; Pietrzak, Maria; Macioła, Agnieszka Institute of Biochemistry and Biophysics Polish Academy of Sciences, Poland Background Indicate the purpose and objective of the research, the hypothesis that was tested or a description of the problem being analyzed or evaluated; It is well established that the virus hemagglutinin is the main antigen, inducing the neutralizing antibodies. The HA gene mutates however fast making the production of a new vaccine very challenging since the vaccine production lasts several months. In the attempt towards developing influenza vaccine production that would be faster and safer we used surface antigen alone. In this report, we describe the expression of HA gene of H5N1 avian influenza virus in simple Pichia pastoris system. rHA was produced in a soluble form with high yield and was shown to be highly immunogenic in animals. Methods Describe the setting/location for the study, study design, study population, data collection and methods of analysis used; The A/swan/Poland/305-135V08/2006 (H5N1- subtype) hemagglutinin (HA) gene was cloned and expressed in yeast Pichia pastoris (P. pastoris). The HA cDNA lacking the C-terminal transmembrane anchor-coding sequence was fused to α-factor leader peptide and placed under control of the methanol-inducible P. pastoris alcohol oxidase 1 (AOX1) promoter. Two P. pastoris strains: SMD 1168 and KM 71 were used for protein expression. rHA fusion protein with His-6 affinity tag was secreted into the culture medium and was purified to homogeneity in one step using Ni-NTA agarose. Glycosylation sites of rHA were determined using LC-MS-MS/MS (liquid chromatography coupled to tandem mass spectrometry). The immunological properties of rHA antigen were tested in vivo. Mice were immunized intradermally with three doses of rHA (1, 5 and 25 μg) given at 3-weekly intervals. The control group received at the same intervals adjuvant only. Chicken were immunized subcutaneously twice with 25 μg of rHA given at 4 weeks interval. After chicken and mice immunization sera samples were tested by ELISA. Results Present as clearly and detailed as possible the findings/outcome of the study, with specific results in summarized form. Recombinant HA antigen was secreted into the culture medium reaching the approximately 15 mg/ L (KM 71 strain). rHA was purified to homogeneity in one step affinity chromatography. SDS-PAGE and MS/MS analysis indicated that the protein is cleaved into HA1 and HA2 domains linked with disulphide bond. Analysis of the N-linked glycans revealed that the overexpressed HA is fully glycosylated at the same sites as the native HA in the vaccine strain. The immunological activity of hemagglutinin protein was tested in chicken and mice, where rHA elicited high immune response. Conclusions Briefly discuss the data and main outcome of the study. Emphasize the significance for influenza prevention, treatment, care and/or support, and implications of the results. The data presented here demonstrate that influenza antigen produced in P. pastoris with good efficiency is highly immunogenic and might be consider as a candidate for subunit vaccine. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P195 POSTE R A BSTRAC TS PL05P20 RSV infection in neonates Hammoud, Majeda Sabri Kuwait university, Kuwait Background Respiratory syncytial virus (RSV) causes frequent nosocomial outbreaks in general pediatric wards but is less commonly reported in neonatal intensive care units. We investigated an outbreak of RSV infection in the neonatal unit at Maternity Hospital and call for a review of the guidelines of palivizumab prophylaxis is suggested. Methods Chart review was performed after an RSV outbreak which occurred in our unit in February 2012. A case of RSV was defined as an infant with a nasopharyngeal aspirate positive for RSV by PCR technique. Management of the infected infants and their outcome were also recorded. Results During the outbreak, 12 preterm infants turned RSV positive (mean age at infection, 38days; mean birth weight, 1457 g; and mean gestational age, 31 weeks). Six infected infants became very sick and required intubation with mechanical ventilation. There was no significant difference in birth weight or gestational age between those who were intubated and the non-‐intubated infants. The RSV-positive patients were isolated, and infection control measures were implemented. Palivizumab was administered to all patients and their contacts and no new cases were subsequently identified. All infants survived Conclusion The current guidelines which recommend palivizumab prophylaxis to preterm infants after discharge during winter season seem to be insufficient to prevent outbreaks in NCUs. Palivizumab combined with infection control measures appears to prevent the spread of RSV in the neonatal setting. More studies are needed to investigate whether the use of palivizumab prophylaxis should start at NCUs in order to reduce RSV outbreaks. TH E FI FTH ESWI I N FLU ENZA CON FER ENC E | 14-17 SEPTEMBER 2014 | R IGA P196
© Copyright 2026 ExpyDoc