Failure to Detect Evidence of Human T-Lymphotropic Virus (HTLV) Type I and Type I1 in Blood Donors With Isolated gag Antibodies to HTLV-1/11 By Renu B. Lal, Donna L. Rudolph, John E. Coligan, Stephanie K. Brodine, and Chester R. Roberts Of the 267,650 blood donations from members of the US armedforces, 72 (0.027%) were serologically confirmedt o be positive for human T-lymphotropic virus type 1/11 (HTLVW) and 379 (0.14%) were Western blot (WB)-indeterminatewith banding pattern restricted t o the proteins encoded by the gag gene only (HTLVind).To determine whether these apparently healthy HTLVindblood donors are infected with HTLV-I or HTLV-II, coded specimens from randomly selected military blood donors (n = 73) were tested for antibodies to HTLV by WB and radioimmunoprecipitationassay (RIPA) using HTLV-I (MT-2) antigens, by enzyme immunoassay using synthetic peptides representing the immunodominant epitopes of HTLV, and for sequences of proviral HTLV DNA by the polymerase chain reaction (PCR). Of the 73 HTLVinddonors, none showed presence of env reactivity by HTLV WB and RIPA. Minimal reactivity was observed with synthetic immunodominant motifs derived from the env protein of HTLV-I (Env-1191-214 and E n ~ - 5 ~ - or ~ ' HTLV-II ) ( E n ~ - 2 ~and ~-*~ Env-2Wlo2)andgag protein (Gag-lalo2-l17 and Gag-1OS3=). A peptide corresponding t o the endogenous retroviral sequence with structural homologies t o the gag protein of HTLVs (RTVLgag)reacted with antibodies not only in HTLVPos (88%) and HTLVind(42% t o 66%) specimens, but also reacted with normal control subjects (60%). Furthermore, none of the 73 HTLVindspecimens demonstrated presence of the HTLV genome when amplified with primersfor thepol and taxlrex region. Six to 23 months from the initial test, 27 subjects still gave indeterminate WB patterns, and 13 of these repeat specimens were still negative for the presence of HTLV genome. We conclude that individuals at low risk for HTLV infection who have HTLVIndWB reactivity are rarely, if ever, infectedwith HTLV-I or HTLV-II. o 1992by The American Society of Hematology. H determined, retrospective studies of recipients of blood with such serum reactivity showed that these recipients were HTLv-I/II-negati~e.~ To better understand the clinical importance of HTLVind,we evaluated a group of blood donors within US armed forces with only HTLVgag reactivity by a number of serologic assays containing whole viral antigens and the immunodominant epitopes of HTLV-I and HTLV-11. The presence of viral DNA in the genome was analyzed by the polymerase chain reaction (PCR), which allows rapid and direct detection of viral DNA through the amplification of specific viral sequences in blood samples?J2 In the present study, analysis of serum from blood donors with HTLVind pattern demonstrated no evidence of HTLV-I or HTLV-I1 infection according to HTLV antibody EIA with synthetic antigens representing the immunodominant epitopes of HTLV-I and HTLV-11, and analysis of peripheral blood mononuclear cells (PBMC) demonstrated no evidence of HTLV-I or HTLV-I1 infection in culture or by PCR assays. UMAN T-LYMPHOTROPIC virus type I (HTLV-I) and I1 (HTLV-11) have been detected worldwide: western Japan and the Caribbean Islands for HTLV-1,' and in American Indians in Panama and in New Mexico for HTLV-II.2,3 These viruses have been detected in blood donors,4.5 recipients of blood transfusions>-8 intravenous drug users? and female prostitutes.1° The criteria for seropositivity, as defined by the US Public Health Service Working Group, is that a serum specimen exhibiting reactivity to p24Bag and gp46"" and/or g~61/68~" be considered seropositive for HTLV-1/11 (HTLVPS)and that a combination of Western blot (WB) and radioimmunoprecipitation assays (RIPA) be used to visualize antibody reactivity togug and any specimen that lacks this pattern of reactivity by either test system is considered WB-indeterminate (HTLVind).Such testing of blood donors within the United States has shown a low seroprevalence (0.01% to 0.025%) of HTLV-I/II.4v6However, greater than 30% of the enzyme immunoassay (EIA) repeat reactive specimens demonstrate reactivity to HTLV-I/II@g proteins on WB assays.6s11 While the importance of such reactivity remains to be From the Retrovirus Diseases Branch, Division of Viral and Rickettsial Diseases, National Center for Infectious Diseases, Centers for Disease Control, Atlanta, GA; the Biological Resource Branch, National Institute of AllergV and Infectious Diseases, National Institutes of Health, Bethesda, MD; the Naval Health Research Center, US Naval Hospital, San Diego, CA; and the Department of Diagnostic Retrovirology, Walter Reed Army Institute of Research, Washington, DC. Submitted September 26, 1991; accepted March 20, 1992. Address reprint requests to Renu B. Lal, PhD, Mail Stop G-19, Retrovirus Diseases Branch, Atlanta, GA, 30333. The publication costs of this article were defrayed in part by page charge payment. This article must therefore be hereby marked "advertisement" in accordance with I8 U.S.C. section 1734 solely to indicate this fact. 0 1992 by The American Society of Hematology. 0006-4971/92/8002-0017$3.00/0 544 MATERIALS AND METHODS Reference HTLVantiboh tests. Serum specimens from all blood donors were initially tested for HTLV-1/11 antibodies with a licensed enzyme-linked immunoassay (HTLV-I EIA, Dupont, Wilmington, DE), according to the manufacturer's recommendations. Specimensthat were repeatedly reactive were further tested by WB incorporatingpurified recombinant HTLV-I envelope (r21) protein with a whole virus lysate derived from an HTLV-I-infected cell line, HUT-102 (Cambridge Biotech, Rockville, MD) and radioimmunoprecipitation assay (RIPA) using a lysate from the MT-2 cell line (Cambridge).A serum specimen was determined to be HTLV-positiveif antibody reactivitywas detected to at least two different HTLV structural gene products (gag p24 and env gp46 and/or gp68). The results were considered indeterminate (HTLVind)for HTLV-1/11, if the WE3 showed at least one band characteristic of HTLV-1/11 (p19, p24, or gp46), but did not meet the criteria for a positive result. Blood donors. Between December 1988and April 1991,approximately 267,650 U of blood from members of the armed forceswere tested for antibodies to HTLV-1/11. Of the total donations, 2,376 Blood, VOI 80, NO2 (July 151,1992: PP 544-550 HTLV-1/11 SERO-INDETERMINATE REACTIVITY (0.89%) were initially reactive by EL4 and hence were tested by 545 with an enzyme-linked immunosorbent assay (ELISA) reader (SLT Lab Instrument, Ronkonkome,NY)at 405 nm. Seropositivity (Table 1). Of these, 72 were HTLVP (0.027%), 379 were HTLVlnd was defined as any value greater than the mean of the normal controls + 2 SD. (0.14%), and 1,925 did not demonstrate any viral specific band (HTLVneg).Additional blood specimens were requested on all of PCR. The amplification and detection of HTLV sequences by the specimens that were HTLVFs and HTLVind. Of the 379 PCR were performed in blinded fashion on DNA specimens from HTLVmd specimens requested, additional blood was sent by HTLVP donors (n = 52) and HTLVinddonors (n = 73). Two gene various blood donation centers for 73 specimens, and hence only regions (pol and tan-rex) from each patient were amplified by PCR these 73 specimens were included for the detailed analysis. using conditions as described previously?J2 Briefly, 50 pL of cell lysate was added to 50 pL of the reagent mixture containing Antibodies to synthetic peptides. The synthetic peptides derived from HTLV-I and HTLV-I1 sequences termed Env-1191-214 dNTPs, primers, and Tuq polymerase (all 2x) in lx PCR buffer (50 (HTLV-I, LPHSNLDHILEPSIPWKSKLLTLV), Env-2187-209 nmol/L KCI, 10 mmol/L Tris-HCI, pH 8.3, 0.1 mg/mL gelatin). (HTLV-11, VHDSDLEHVLTPSTSWTTKILKFI), Env-5242-z7 The optimal concentrations determined were dNTF's, 200 pMol/L each; primers, 0.5 pmol/L each; Tuq polymerase, 1 U, and MgC12, (HTLV-I, SPNVSVPSSSSTPLLY),Env-20s5-1M (HTLV-11,KKF"1.25 mmol/L. The amplification conditions followed were denaturRQGLGYYSPSYNDP), Gag-la102-117 (HTLV-I, PPSSPTHDPPation at 94°C for 90 seconds; annealing at 58°C for 2 minutes; exDSDPQI), Gag-1@M-385 (HTLV-1/11, GHWSRDCTQPRPPPGPCtension at 72°C for 1minute, for 40 cycles. Ten microliters of PCR PLCQDP),13-15and an endogenous retroviral sequence containing productswas hybridized with 32Pend-labeledoligonucleotideprobes the histidine tRNA primer binding site with sequence homologies in solution at 53°C and 4YC, respectively. The 5'-3' sequences of to the C-terminus of HTLVgag protein (RTVLBag,PRIPPKPCPICthe primer pairs and probes from the pol region,12 based on VGPHWKSDCPT)16were synthesizedby 9-fluorenylmethyloxycarbony1 (FMOC) chemistry, and antibodies to these synthetic pepHTLV-I (GenBank accession no.502029) and HTLV-I1 (GenBank accession no. M10060) sequences were as follows: SKllO (pol, tides were tested as described previo~sly.'~ Briefly, polyvinyl plates (Immulon 11; Dynatech Laboratories, Alexandria, VA) were coated HTLV-147574778, HTLV-I14735-4756), CCCTACAATCCAACCAGCTCAG, SK111 (pol HTLV-14942-4919, HTLV-I149B4897), GTGGTwith 50 pL of synthetic peptides (100 pg/mL) in 0.01 mol/L carbonate buffer, pH 9.6, and incubated overnight at 4°C. The GAAGCTGCCATCGGGm, SK112 (pol, HTLV-14825-4840), plates were washed six times with phosphate-bufferedsaline (PBS) GTACTTTACTGACAAACCCGACCTAC; and SK188 @of, containing 0.05% Tween-20 (PBS-T); excess reactive sites were HTLV-I148804w8), TCATGAACCCCAGTGGTAA.The hybridized products were electrophoresed on 10% polyacrylamide gels and blocked by addition of 3% bovine serum albumin (BSA) in PBS-T, autoradiographed. followed by the addition of a 120 dilution of each test serum. The plates were incubated overnight at 4°C. After six washes, FcFor taulrex amplification? 50 pL of the cell lysate was added to the 2 x lo6 cpm of 5'-labeled primer, dNTPs (50 pmol/L), Tug specific, alkaline phosphatase-njugated goat antibody to human polymerase (2.5 U), and MgClz (1.25 mmol/L). The primers used IgG (Sigma, St Louis, MO) was added, followed by the addition of were Txl (taulrex, HTLV-17336-7353,HTLV-I17248-n66), p-nitrophenyl phosphate (Sigma) substrate. The plates were read CGGATACCCAGTCTACGT; and Tx2 (tmlrex,HTLV-17494-7474, HTLV-I17406 Table 1. Serologic Analysis of HTLV-1/11Antibodies and PCR Results 7386),GAGCCGATAACGCGTCCATCG.The amplification conin Armed Forces Blood Donors ditions were similar to those described above, except the annealing temperature was 55°C. For differentiation between HTLV-I and PCR Results' HTLV-11, the amplified products were digested with restriction WB/RIPA Results (no. poslno. tested) enzymes Tuq Z and Suu 3.4, and the products were electrophoresed 6-23mo 6-23mo on 8% polyacrylamide gels and autoradiographed. For HTLV-I, Variables Original Later Original Later the 159-nucleotide (nt) product was digested by Tuq Z to a 138-nt HTLVpst 72 (0.027) product and by Suu 3.4 to a 120-nt fragment. For HTLV-11, the 43 30/30 36/36 HTLV-I 28/28 159-nt product was digested by Tuq Z to an 85-nt fragment; Suu 3A HTLV-II 29 25/25 16/16 13/13 did not cleave HTLV-11. A specimen was considered positive by HTLVW 0127 0173 0113 379 (0.14) PCR if HTLV sequences were detected by both primer pairs. 4 r21+p19+p24+ 013 012 012 If a specimen was positive on one of the two amplifications, a ND 10 r21+p19+p24ND 011 third amplification was performed to determine positivity or 75 r21+pl9-p24+ 012 014 012 negativity. A specimen was considered to be HTLV-negative by p19+p24+ 0110 28 011 012 PCR if there were no detectable HTLV sequences when cells were 0/12 61 p24+ 012 015 analyzed in duplicate for each of the two primer pairs. ND ND 12 r21+ 015 Isolation of HTLV-I and HTLV-11. PBMC from HTLVps and 0116 0138 p19+ 016 25711 HTLVindwere cultured for virus isolations. Briefly, PBMC were HTLV'W ND ND 0/26 1,925 stimulated with 1% PHA-P (Difco, Detroit, MI) and cultured at a density of 2 x lo6 cells/mL in complete RPMI-1640 (C-RPMI) "PCR results were determined to be positive based on genomic supplemented with 15% fetal bovine serum and 10% partially amplification inpol and taxlrex region. tHTLVPosresults were based on seroreactivity to the gag and env purified interleukin-2 (IL-2; Advanced Biotechnologies, Silver Spring, MD). After 72 hours of culture, the lymphocytes were gene products. cocultured with an equal number of phytohemagglutinin (PHA)SHTLVindresults were based on seroreactivity to gag (p24 and/or p19) and/or recombinant transmembrane protein (r21) only. stimulated PBMC from a normal donor. The culture supernatants were collected twice a week for up to 4 weeks. Soluble HTLV §Two specimens were from persons infected with human immunodeficiency virus. antigen production was determined by an antigen capture assay using a monoclonal antibody to HTLV p24gag that recognizes ([Onehundred twenty-eight specimens within this group had some nonspecific bands at 28 Kd and 26 Kd, in addition to p19 band. epitopes common to both HTLV-I and HTLV-I1 (Coulter ImmuIHTLV"g specimens did not show any reactivity on WB assay. nology, Hialeah, FL).17 WB and RIPA for serologic confirmation of HTLV infection 546 LAL ET AL RESULTS HTLV-anrihody resting results. Of the 267,650 U of donated blood, 2,376 (0.89%) were HTLV-1/11 EIAreactive. Of these, 72 were confirmed to be positive for HTLV-1/11 (0.027%), 379 were HTLVind(0.14%), and 1,925 were negative. Further analysis of the 72 seropositive specimens by type-specific oligopeptidestwand oligoprimers9.I2demonstrated that 43 were infccted with HTLV-I (60%), and 29 with HTLV-I1(40%). Characreri.ytic WR-indeterminatepatrem. The WB analysis of HTLVV specimens demonstrated reactivity to both gag (p53 gag precursor; p36, p32, and p28 intermediate products; p24 and p19gag products) and env (gp46 external glycoprotein; r21e recombinant transmembrane protein) gene products (Fig 1A). All of the specimens that did not react with env gp46 protein were further subjected to RIPA analysis to detcrmine the presence of the env precursor gp68 (Fig 1B). While both HTLV-I and HTLV-I1 specimens demonstrated presence of the gp68 band, none of the sero-indeterminate specimens had env reactivity. The WB analysis of all HTLVlndspecimens (Table 1) demonstrated A HTLV-I P53 \ 9P46 c p42 p36 p32 ' ' ' p28 p24 -a - - i1-1 HTLV-I I; HTLV-II il HTLV-II HTLVd 11 HTLV" - p26 p24 Fig 1. HnV-speclfic WB (A) and RIPA (6)analysis on paired serum specimens from HTLV-I-, HTLV-II-, and HTLW individuals. HTLVCpositive serum specimens reacted with bothg8g (p53 precursor and p24, p19 g8g products) and 8nv (gp48 and 1210) proteins (A); HTLV-II and HTL\Pd specimens did not react with the native envelope. RIPA analysis ( 8 ) of HTLV-I- and HTLV-ll-positive specimens demonstrated a band at env precursor gp68, and g8g product p24 and gag intermediary processed product at p26; none of the H T L W specimens reacted with gp68. pl9+ p24+ R1+ YOpositivity Fig 2 Percent serareactivity of HnW and HTLW specimens with synthetic peptides representingthe immunodominantepitopes of env (A), and gsg and an endogenous retroviral sequence (8).The majority d HTLV- specimens (p24*gp46+; n = 30) reacted with synthetic Env-llel.z14 (0). Env-YU.s7(El), Env-2'"(E),and Env-ZOrrl" (: ) in (A), and synthetic Gag-la"Jz.117(0). Gag-10-m (E!), and an in (6).in contrast, serum endogenous retroviral sequence RTVLW (3) specimensfromHTLVM individualswith either p19/p24+r21' (n = 12) or p19'p24* (n = 10). or p19' (n = 43). or p24' (n = 6) or r21* (n = 9) demonstrated minimal reactivity with all of the peptides except Gag-la (8). that the most common indeterminate band pattern showed a single band at p19 (257 of 379,68%), which was followed in frcquency by groups having a single band at p24 (61 of 379, Ih%), bands at p19 and p24 (28 of 379,7%), bands at p19 and/or p24 along with rcactivity to r21eW(21 of 379, 5.6%), and a single band at r21eW(12 of 379,3%). None of the specimens with HTLVindpattem demonstrated any envelope reactivity on WB or RIPA analysis using lysates derived from cell line infected with HTLV-I or HTLV-11. W B analyses were repeated for 27 of the 379 HTLVind specimens with samples drawn 6 to 23 months after the original bleed (Table 1). No differences in the banding pattern were seen for 25 of 27 of these specimens, one of the specimens with a p19+p24+pattem lost p24 reactivity, and one of the p19+ specimens was positive for r21" reactivity upon rebleed. Antibody responses IO immunodominant HTL V epitopes. As the affinity and avidity of antibodies in serum may affect their detection in standard serologic assays using virally infected whole cell lysates, we sought to determine the antibody reactivity to synthetic peptidcs representing immunodominant structural motifs of HTLV-I and HTLV-II.tZ-15 While serum specimens from 92% to 99% of HTLV-Iinfccted persons reacted with HTLV-I-specific env cpitopes (Env-1191-214and E n ~ - 5 ? ~ *respectively, - ~ ~ ~ ) , minimal reactivity (0% to 12%) was observed with specimenswith HTLVInd pattern (Fig 2A). Similarly, while serum specimens from 75% to 96% of HTLV-11-infected persons reacted with HTLV-II-specific env epitopes ( E n ~ - 2 ' ~and ' - ~Env-2Ps102). respectively, minimal reactivity (0% to 5%) was observed with HTLVindspecimens. Analysis of synthetic peptides derived from the C-terminus of p19 (Gag-la1n2?-1t7) and the N-terminus of p15 (Gag-10w3HS)demonstrated 65% to 95% reactivity with HTLVV specimens. Among the HTLV-1/11 SERO-INDETERMINATE REACTIVITY 547 HTLVindspecimens, 23% of those that gave only p19 WB product with either primer/probe combination. Of the 13 individuals with HTLVindpatterns collected 6 to 23 months band reacted with Gag-la; all other specimens had minimal reactivity with Gag-la or Gag-10 (Fig 2B). after the original testing, none demonstrated a presence of the HTLV genome in any of the specimens (Table 1). The expression of endogenous retroviral gene products may also provide an antigenic stimulus for production of Detection of HTLV p24 antigen in cultured lymphocytes. antibodies that may be cross-reactive with HTLVaaR proPBMC from six HTLVP and 20 randomly selected HTteins. We therefore synthesized peptides derived from an LVinddonors were cocultured as described in the Methods. endogenous rctroviral element having a histidine tRNA While four of the six HTLVW donors (66%) demonstrated primer binding site (RTVL-H) that has 60% homology with a presence of p24gug antigen in the culture supernatant by 14 days, none of the HTLVinddonors had any detectable the C-terminus of HTLV-I and HTLV-11 (RTVLsag).l6 levels of p24 antigen when assayed during 4 weeks in While 88% of HTLVV specimens reacted with this peptide, 42% to 66% of the serum specimens from HTLVand culture (data not shown). specimens reacted with RTVLBag(Fig 2B). However, analyDISCUSSION sis of HTLVncgspecimens demonstrated that 60% of these specimens also react with this peptide. The serologic confirmation of HTLV-I and HTLV-I1 infection depends on the presence of antibody reactivity to Detection of HTLV DNA sequences in blood donors. To determine the presence or absence of HTLV DNA in gug and env gene products.45 Using these criteria, 72 of the total donations were HTLV-positive (43 were HTLV-I and persons with HTLVindWB pattern, peripheral blood lym29 were HTLV-II), giving an overall seroprevalence rate of phocytes were analyzed by PCR. We chose primer pairs 0.027% in military blood donors. These rates are in general from the pol and tax-rex region, both of which are highly conserved among HTLV-I and HTLV-11. Regions from gag agreement with previous studies, in which random US blood donors have demonstrated a seropositivity rate of were not amplified due to some sequence homology with 0.01% to 0.02%. with an equal distribution of HTLV-I and endogenous rctroviral sequences16J9and regions from env were excluded due to variation in different isolate seHTLV-II.4J' quences.MIn accordance with previous studies, both primIndividuals with only gug antibodies are frequently eners from the pol and tuxlm regions were highly sensitive in countered during blood donor screening assays and are referred to as HTLV-indeterminate (HTLVind).Among identifying HTLVV specimens (all of the 52 HTLVV gave these HTLVindblood donors, the most common reactivity a detectable signal). None of the 26 HTLVncgspecimens reacted with any of the primer/probe combinations, further was directed against the p19gag, followed by antibody reactivity to p24gag. The structural similarity of the gag confirming the specificity of these primers. A representative analysis of PCR amplified and hybridized products from epitope(s) with other microbial and cellular HTLV-positive and -indeterminate specimens is shown in and the immunogenic nature of the C-terminus of plVag14 Fig 3. may account for this reactivity. Indeed, 23% of the specimens with p19 reactivity in WB assays demonstrated Analysis of DNA from the 73 HTLVindspecimens (Table antibody responses to a synthetic Gag-la1m-"7epitope that 1) demonstrated that none of the specimens amplified any A lax Flg 3. PCR analysis of four specimens each from HTLV-I, HTLV-II, and H T L P individuals. (A) AmplMcation products using consensus t s x l r e x primers, which ampllfieda 159-nt product from both HTLV-I and HTLV-II specimens; none of the H T L W specimens were amplified. HTLV-I- (MT-2) and HTLV-II(Mo-T) Infected cell lines were used as positive controls; the numbers under the controls indicate number of positive cells diluted to 300K with negative donor cells. ( 8 ) For pol amplification, consensus primers were used for amplificationof a 186-nt product, followed by hybridization with HTLV-I- (SK112) and HTLV-lC(SK188) specific probes. As expected, the hybridization product for SK112 was seen only in MT-2, and for SK188 was seen only in the Mo-T cell line. HTLV-I HTLV-II HTLW Control MT-2 MO-T 1 5 5 0 1550 B Pol ? m i - - 1550 - . 50 _=- SK188 50 1550 LAL ET AL 548 has previously been shown to represent the type-specific immunodominant epitope of HTLV-I.x Furthermore, monoclonal antibodies to p19gag have been shown to react with antigens of normal thymus or human p l a ~ e n t a ? ~In. ~ ~ addition, the C-terminus of HTLVWg has significant homologies with the amino-terminal segment of myelin basic protein and may have potential for false-positive antibodiesF3 Isolated gag reactivity in the absence of env reactivity could be due to either low sensitivity of current assays available for detection of env reactivity or to cross-reactivity with a closely related retroviral protein, or the reactivity may represent early HTLV infection. Lack of antibody response to the envelope proteins in WB and RIPA assays using both HTLV-I and HTLV-I1 antigens, as well as minimal reaction to synthetic immunodominant motifs derived from the envelope proteins of HTLV-I and HTLV-I1 (Env-1, Env-2, Env-5, Env-20), further confirms that persons with only gag antibodies do not contain HTLV env reactivity. However, the possibility that the lack of env reactivity might be due to minimal viral load resulting in the lack of a threshold immunogenic signal cannot be ruled out. Alternatively, individuals with isolated gag reactivity might be infected with a variant form(s) of HTLV viruses that possess significantly divergent envelope proteins, and therefore these individuals do not react with prototypic viral strains. Such variant forms of viruses have lately been isolated from Papua New Guinea." Because gag antibodies are among the first antibodies to appear following seroconversion,8 the possibility that isolated gag antibodies in HTLVindspecimens may represent early seroconverters still remains. However, DNA from PBMC from none of the specimens with gag reactivity demonstrated presence of the HTLV genome as determined by PCR analysis. More importantly, rebleeds on a limited number of specimens taken 6 to 23 months after initial testing demonstrated similar banding patterns on WB, did not show env reactivity on RIPA, and PCR analysis of DNA from PBMC remained negative for HTLV sequences. Moreover, a retrospective study of recipients of blood from blood donors with HTLVkd patterns has demonstrated no evidence of seroconversion to HTLV when followed up for 1 year.7 Antibodies to a recombinant transmembrane glycoprotein (r21e) have recently been shown to be another marker of early seroconversion to HTLV.8 In the present study, none of the specimens with r21envand gag antibody demonstrated the presence of the HTLV genome by PCR analysis; this finding would argue against this reactivity representing true seroconversion in this population. The antigenic mimicry of endogenous retroviral sequences (ERS) with gag proteins of HTLV could be responsible for gag reactive antibodies.28 We found antibody responses to a synthetic peptide derived from the ERS (RTVLgag)both in HTLVFs, HTLVind,and HTLVnegspecimens. The ERS has 60% homology with the 50-amino acid sequence at the C-terminus of gag.16 This gag region of HTLV contains the highly conserved retroviral motif, CX2C&H&C, present in other type C retroviruses, as well as in human immunodeficiency virus, and is thought to be involved in the binding of this protein to the retroviral genome.29The RTVL region contains two imperfect copies of this conserved sequence in a location similar to that found in other retroviruses (Table 2). In addition, another ERS contains two open-reading frames potentially encoding for 25-Kd and 15-Kd proteins and shows 32% to 39% homology with the gag protein of HTLV-I/II.19 While the majority of ERS are structurally defective and not expressed as infectious viruses, the expression of certain portions of the ERS gene products may provide an antigenic stimulus for the production of antibodies. RTVLgag appears to be one of such epitopes that induce antibody responses both in HTLV-infected and -uninfected persons. Expression of endogenous retroviral proteins has been noted in the syncytiotrophoblastic cells of placenta,30which were antigenically related to the major core protein p30, encoded by the gag gene of known retroviruses. Furthermore, antibodies to p30gag have been detected in human leukemic and autoimmune sera.31,32 In our search for the HTLV genome in individuals with the HTLVindpattern, we focused onpol and taxlrex regions, as these are highly conserved in HTLV-I and HTLV-11. While all of the HTLVpos specimens demonstrated the presence of the HTLV genome, none of the DNA from specimens with HTLVindamplified with eitherpol or taxlra primers. Attempts to isolate the HTLV virus by the coculture technique from a limited number of specimens did not reveal evidence of HTLV antigens, further providing evidence that individuals with HTLVindpattern are not infected with HTLV. However, it would be pertinent to add that, because of the cell-associated nature of HTLV, virus isolation is not a sensitive procedure for detecting HTLV.17 Although the mechanism of these serum reactivities to gag proteins remains unknown, the failure of the PCR to detect evidence of HTLV infection in HTLVindspecimens, as observed by us and by 0thers,3~,~~ seems to rule out the possibility that these reactivities correspond to the expression of HTLV gag proteins. Similar observations have recently been made in HTLVindpopulations from Melanesia, where none of the HTLVindspecimens demonstrated Table 2. Sequence Homology Between the C-Terminus of gag Containing Gag-10 Sequence and an Endogenous Retrovirus-Like Element Containing Histidine tRNA Primer Binding Site (RlVL-H) Sequence* Name *** * * * *** * * * ** *** * * * * *** PKKPPPNQPCFRCGKAGHWSRDCTQPRPPPGPCPLCQDPTHWKRDCPR PPEPPPPGACYKCQKSGHWAKE PQPR I PPKPCP I CVGP . HWKSDCPT . _______~ ~~~ *Asterisks denote homologous amino acids in the gag protein and RNL-H. Bold letters signify the conserved CX,C&H&C introduced in RNLgag sequence to maintain maximal alignment. motif. Two gaps were HTLV-1/11 SERO-INDETERMINATE REACTIVITY 549 presence of HTLV genome using either HTLV-prototypic strain-specific primers or Melanesian-specific primers.35 While continued efforts are needed to determine the cause of these atypical HTLV WB results, our failure to detect env reactivity using whole viral antigens or synthetic immu- nodominant structural motifs of HTLV-I and HTLV-11, failure t o detect viral antigens in cultured PBMC, and failure to amplify HTLV sequences from these individuals, suggests that isolated gag reactivities in army blood donors d o not represent a true HTLV infection. REFERENCES 1. Manns A, Blattner W A The epidemiology of the human T-cell lymphotropic virus type I and type 11: Etiologic role in human disease. Transfusion31:67, 1990 2. Lairmore MD, Jacobson S , Gracia F, De BK, Castillo L, Larreategui M, Roberts B, Levine PH, Blattner WA, Kaplan JE: Isolation of human T-lymphotropic virus type 2 from Guaymi Indians in Panama. Proc Natl Acad Sci USA 87:8840,1990 3. Hjelle B, Mills R, Swenson S, Mertz G, Key C, Allen S: Incidence of hairy cell leukemia, mycosis fungoides, and chronic lymphocytic leukemia in first known HTLV-11-endemic population. J Infect Dis 163:435, 1991 4. Anderson DW, Epstein JS, Lee TH,Lairmore MD, Saxinger C, Kalyanaraman VS, Slamon D, Parks W, Poiesz BJ, Pierik LT, Lee H, Montagna R, Roche PA, Williams A, Blattner W Serological confirmation of human T-lymphotropicvirus type I infection in healthy blood and plasma donors. Blood 742585,1989 5. Centers for Disease Control: Human T-lymphotropic virus type-1 screening in volunteer blood donor-United States-1989. Morbidity Mortality Weekly Rep 39:915,1990 6. Sandler SG, Fang C, Williams A Retroviral infections transmitted by blood transfusion.Yale J Biol Med 63:353,1990 7. Shih JWK, Lee HH, Flachek M, Canavaggio M, Jett BW, Allain JP, Alter HJ: Transfusion-transmittedHTLV-1/11 infection in patients undergoing open-heart surgery. Blood 75546,1990 8. Manns A, Murphy EL, Wilks R, Haynes G, Figueroa JP, Hanchard B, Barnett M, Drummond J, Waters D, Cerney M, Seals JR, Alexander S S , Lee H, Blattner W A Detection of early human T-cell lymphotropic virus type I antibody patterns during seroconversion among transfusion recipients. Blood 77:896,1991 9. Lee H, Swanson P, Shorty VS, Zack JA, Rosenblatt JD, Chen I: High rate of HTLV-I1 infection in seropositive IV drug abusers in New Orleans. Science 244471,1989 10. Khabbaz RF, Darrow WW, Hartley TM, Witte J, Cohen JB, French J, Gill PS, Potterat J, Sikes RK, Reich R, Kaplan JE, Lairmore MD: Seroprevalance and risk factors for HTLV-1/11 infection among female prostitutes in the United States. JAMA 263:60,1990 11. Hartley TM, Khabbaz RF, Cannon RO, Kaplan JE, Lairmore MD: Characterization of antibody reactivity to human T-cell lymphotropicvirustypes I and I1 using immunoblot and radioimmunoprecipitation assays. J Clin Microbiol28:646,1990 12. Kwok S , Kellogg D, Ehrlich G, Poiesz B, Bhagwati S , Sninsky JJ: Characterization of a sequence of human T-cell leukemia virus type I from a patient with chronic progressive myelopathy.J Infect Dis 158:1193,1988 13. La1 RB, Rudolph DL, Lairmore MD, Khabbaz RF, Garfield M, Coligan JE, Folks TM: Serologicdiscrimination of HTLV-I and HTLV-I1 infection by using a synthetic peptide-based enzyme immunoassay. J Infect Dis 163:41,1991 14. La1 RB, Rudolph DL, Griffis KP, Kitamura K, Honda M, Coligan JE, Folks TM: Characterization of immunodominant epitopes of gag and poZ gene encoded proteins of human T lymphotropicvirus type-I. J Virol65:1870,1991 15. La1 RB, Rudolph DL, Kaplan JE, Hjelle B, Levine PH, Coligan JE, Viscidi RP: Identification of immunodominantepitopes in envelope glycoprotein of human T-lymphotropic virus type-11. Virology 186:274,1992 16. Mager DL, Freeman JD: Human endogenous retroviruslike genome with type C pol sequences and gag sequences related to human T-cell lymphotropicviruses. J Virol61:4060,1987 17. Toedter G, Pearlman S, Hofheinz D, Blakeslee J, Cockerel1 G, Dezzutti C, Yee J, La1 RB, Lairmore M: Development of a monoclonal antibody based p24 capsid antigen detection assay for HTLV-I, HTLV-11, and STLV-I infection. AIDS Res Hum Retro 8527,1992 18. La1 RB, Heneine W, Rudolph DL, Present WB,Hofhienz D, Hartley TM, Khabbaz RF, Kaplan JE: Synthetic peptide-based immunoassays for distinguishing between human T-lymphotropic virus type-I and type41 infections in seropositive individuals.J Clin Microbiol292253,1991 19. Per1 A, Rosenblatt JD, Chen ISY, DiVincenzo JP, Bever R, Poiesz J, Abraham GN: Detection and cloning of new HTLVrelated endogenous sequences in man. Nucleic Acids Res 176841, 1989 20. Ratner L: Molecular variation of human T-lymphotropic viruses and clinical association, in Blattner WA (ed): Human RetrovirologyHTLV. New York, NY,Raven, 1990, p 49 21. Hayes CG, Burans JP, Oberst RB: Antibodies to human T lymphotropic virus type I in a population from the Philippines: Evidence for cross-reactivitywith Plasmodium falciparum. J Infect Dis 163:257,1991 22. McLauglin GL, Benedir MJ, Campbel G H Repeated immunogenic amino acid sequences of Plasmodium species share sequence homologieswith proteins from humans and human viruses. Am J Trop Med Hyg 37:258,1987 23. Liquori AM: Myelin basic protein (MBP) displayssignificant homologies with gag core proteins of HTLV retroviruses. J Theor Biol 148:279,1991 24. La1 RB, Brodine SK, Coligan JE, Roberts CR: Differential antibody responsivenessto pl9gag results in serologicaldiscrimination between human T-lymphotropicvirus type I and type 11. J Med Virol35:232,1991 25. Haynes S, Kiyokawa T, Imagawa KI, Shimizsu F, Hashimura E, Seiki M, Yoshida M: Monoclonal antibody against human T-cell leukemia virus p19 defines a human thymic epithelial antigen acquired during ontogeny. J Exp Med 157:907,1983 26. Suni J, Narvanen A, Wahlstrom T, Lehtovirta P, Vaheli A Monoclonal antibody to human T-cell leukemia virus p19 defines polypeptide antigen in human trimester placentas. Int J Cancer 33:293,1984 27. Yanagihara R, Nerurkar VR, Garruto RM, Miller MA, Leon-Monzon ME, Jenkins CL, Sanders RC, Liberski PP, Alpers MP, Gajdusek DC: Characterization of a variant of human T-lymphotropic virus type I isolated from a healthy member of a remote, recently contacted group in Papua New Guinea. Proc Natl Acad Sci USA 88:1446,1991 28. Abraham GN, Khan AS: Human endogenous retroviruses and immune disease. Clin Immunol Immunopathol56:1,1990 29. Covey S N Amino acid sequence homology in gag region of reverse transcribing elements and the mat protein gene of cauliflower mosaic virus. Nucleic Acids Res 14:623,1986 30. Suni J, Narvanen A, Wahlstrom T, Ah0 M, Pakkanen R, Vaheri A, Copeland T, Cohen M, Oroszlan S: Human placental syncytiotrophoblasticMR75,000 polypeptide defined by antibodies 550 to a synthetic peptide based on a cloned human endogenous retroviral DNA sequence. Proc Natl Acad Sci USA 81:6197,1984 31. Hehlmann R, Schetters H, Erfle V, Leib-Mosch C Detection and biochemical characterization of antigens in human leukemic sera that cross react with primate C-type viral proteins (M, 30,000). Cancer Res 43:392,1983 32. Query CC, Keene JD: A human autoimmuneprotein associated with U1 RNA contains a region of homology that is crossreactive with retroviral p3Wg antigen. Cell 51:211,1987 33. Kwok S, Lipka JJ, McKinney N, Kellogg DE, Poiesz B, Foung SKH, Sninsky JJ: Low incidence of HTLV infections in LAL ET AL random blood donors with indeterminate western blot patterns. Transfusion 30491,1990 34. Khabbaz RF, Heneine W, Grindon A, Hartley TM, Shulman G, Kaplan J Indeterminate HTLV serologic results in US blood donors: Are they due to HTLV-I or HTLV-II? J AIDS 5:400,1992 35. Nerurkar VR,Miller MA, Leon-Monzon ME, Ajdukiewicz AB,Jenkins CL, Sanders RC, Godec MS, Garruto RM, Yanagihara R Failure to isolate human T lymphotropicvirustype I and to detect variant-specific genomic sequences by polymerase chain reaction in Melanesians with indeterminate Western immunoblot. J Gen Virol (in press)
© Copyright 2026 ExpyDoc