Protein Sequencing Edman Degradation • Phenyl isothiocyanate is reacted with the N-terminal amino acid. Unreacted phenyl isothiocyanate is removed and the peptide bond is broken. The derivative of the first amino acid is converted into a more stable form and identified by chromatography. H+ N C R1 O S H 2N C C R2 O R3 O R4 O N C C N C C N C C H H H H R1 O H+ R2 O R3 O N C C N C C N C C S H H H H H S R2 O O H N C C N 2 H N C N C C N C HN H H H H H H R4 O H H R3 O R4 O C C N C C H H H R1 • The reaction cycle is repeated with the shortened polypeptide and the derivative of the second amino acid is identified by chromatography. H+ N C R2 O S R3 O R4 O N C C N C C H H H H R2 O H+ R3 O R4 O N C C N C C S H H H H H S R3 O O H N C C N 2 H 2N C C H N C N C C N C HN H H H H R4 O C C H R2 • By repeating the reaction cycle N-terminal amino acid sequences of up to fifty residues can be determined. Biochemistry Handout 09.1 Use of Peptide Fragments in Sequencing • The information below can be used to generate the complete amino acid sequence of the polypeptide chain. Entire Polypeptide 1: AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHDQHIQLQLSAESVGE… CnBr Fragments 1: AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHDQHIQLQLSAESVGE… 2: DTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSC… NTCB Fragments 1: CSNGGHDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEE… 2: CLFLERLEENHYNTYISKKHAEKNWFVGLKKNGS 3: AEGEITTFTALTEKFNLPPGNYKKPKLLY 4: CKRGPRTHYGQKAILFLPLPVSSD Answer: Determining Evolutionary Relationships from Protein Sequences • The information below can be used to determine the evolutionary relationships of species A, B, and C. Species Amino Acid Sequence A Ala-Met-Phe-Gly-Asp-Leu-Gln-Arg-Thr-Pro B Ala-Met-Val-Gly-Asp-Ile-Gln-Arg-Thr-Pro C Ala-Met-Val-Ala-Glu-Leu-Gln-Arg-Arg-Pro Answer: Biochemistry Handout 09.2
© Copyright 2025 ExpyDoc