Published Ahead of Print on November 14, 2014, as doi:10.3324/haematol.2014.115113. Copyright 2014 Ferrata Storti Foundation. JAK2, CALR, and MPL mutation spectrum in Japanese myeloproliferative neoplasms patients by Shuichi Shirane, Marito Araki, Soji Morishita, Yoko Edahiro, Hiraku Takei, Yongjin Yoo, Murim Choi, Yoshitaka Sunami, Yumi Hironaka, Masaaki Noguchi, Michiaki Koike, Naohiro Noda, Akimichi Ohsaka, and Norio Komatsu Haematologica 2014 [Epub ahead of print] Citation: Shirane S, Araki M, Morishita S, Edahiro Y, Takei H, Yoo Y, Choi M, Sunami Y, Hironaka Y, Noguchi M, Koike M, Noda N, Ohsaka A, and Komatsu N. JAK2, CALR, and MPL mutation spectrum in Japanese myeloproliferative neoplasms patients. Haematologica. 2014; 99:xxx doi:10.3324/haematol.2014.115113 Publisher's Disclaimer.0 E-publishing ahead of print is increasingly important for the rapid dissemination of science. Haematologica is, therefore, E-publishing PDF files of an early version of manuscripts that have completed a regular peer review and have been accepted for publication. E-publishing of this PDF file has been approved by the authors. After having E-published Ahead of Print, manuscripts will then undergo technical and English editing, typesetting, proof correction and be presented for the authors' final approval; the final version of the manuscript will then appear in print on a regular issue of the journal. All legal disclaimers that apply to the journal also pertain to this production process. JAK2, CALR, and MPL mutation spectrum in Japanese myeloproliferative neoplasms patients Shuichi Shirane1, Marito Araki2, Soji Morishita2, Yoko Edahiro1, Hiraku Takei1,3, Yongjin Yoo4, Murim Choi4, Yoshitaka Sunami1, Yumi Hironaka1, Masaaki Noguchi5, Michiaki Koike6, Naohiro Noda7, Akimichi Ohsaka2, Norio Komatsu1 1Department of Hematology, Juntendo University School of Medicine, Tokyo, Japan; 2Department of Transfusion Medicine and Stem Cell Regulation, Juntendo University Graduate School of Medicine, Tokyo, Japan; 3Department of Life Science and Medical Bioscience, Waseda University, Tokyo, Japan; 4Department of Biomedical Sciences, Seoul National University College of Medicine, Seoul, Korea; 5Department of Hematology, Juntendo Urayasu Hospital, Chiba, Japan; 6Department of Hematology, Juntendo Shizuoka Hospital, Shizuoka, Japan; 7Biomedical Research Institute, National Institute of Advanced Industrial Science and Technology (AIST), Ibaraki, Japan Corresponding Author: Norio Komatsu, Department of Hematology, Juntendo University School of Medicine, 2-1-1 Hongo, Bunkyo-ku, Tokyo, 113-8421 Japan; e-mail: [email protected] Letter to the Editor Recurrent somatic mutations in the JAK2, MPL, and CALR genes have been described in patients diagnosed with Philadelphia-negative myeloproliferative neoplasms (MPN), including polycythemia vera (PV), essential thrombocythemia (ET), and primary myelofibrosis (PMF). These mutations are generally mutually exclusive, and their profiles in different disease entities are diverse. In PV, JAK2 mutations exist in approximately 95% of patients. However, in ET and PMF patients, , , and JAK2 CALR MPL mutations are present at frequencies of approximately 60%, 20%, and 5%, respectively1. To further understand MPN pathogenesis associated with the ET and PMF induced by different gene alterations, classification and epidemiological examination of patients according to gene alterations have been performed. In ET, the CALR mutation is associated with a lower hemoglobin level, higher platelet count, lower leukocyte count, and younger age compared with the JAK2V617F mutation2-5; similar characteristics have been observed in PMF patients6, 7. The CALR mutation is also associated with male predominance2, 5, lower thrombosis risk4, 6, and better overall survival6; however, these characteristics are not always evident and are diverse in some cases. The same gender ratio has been reported in a Chinese cohort of ET patients with JAK2 and CALR mutations4. The variation between cohorts in the published data most likely reflects different genetic backgrounds in the different ethnic groups that were studied. In addition, because all analyses have been performed in Caucasian populations, with the exception of one study from China4, the epidemiological evidence regarding the Asian population is limited. Here, we studied a Japanese MPN cohort that was previously characterized with respect to the JAK2V617F mutation; the cohort consisted of 66 PV, 112 ET, and 23 PMF patients, as defined by the 2008 World Health Organization (WHO) criteria8. Clinical and laboratory parameters were obtained at the time of first diagnosis or when genomic DNA samples were collected. This study was conducted in accordance with the Declaration of Helsinki and was approved by the ethics committee of Juntendo University School of Medicine (IRB#2012208 #2013020). and All patient specimens that were previously analyzed for the JAK2 mutation8 were assessed for and CALR MPL mutations using polymerase chain reaction (PCR)-based assays and subsequent deep-sequencing. In addition, the specimens that exhibited a V617F mutant allele frequency below 10% in the previous JAK2 study were re-evaluated via deep sequencing (see supplemental data). Re-evaluation identified 1 PV and 2 ET patients as negative for the PCR-based assay previously identified as JAK2 mutation whom a V617F-positive with a low allele JAK2 frequency. Conversely, JAK2 mutations in MPN patients who were negative for JAK2, , and MPL CALR mutations by PCR-based assays were not identified by deep sequencing (see below for MPL and CALR mutation detection). Thus, JAK2 mutations were found in 64 (97%) PV (including 3 exon 12 mutations), 61 (54.5%) ET, and 11 (47.8%) PMF patients in this cohort (Figure 1A). The W515K/L mutation was assessed using a newly developed MPL allele-specific PCR technique called dual amplification refractory mutation system PCR (DARMS-PCR) and subsequent capillary electrophoresis9. All identified MPL mutations were further verified using deep sequencing. In addition, by screening MPN patients who were previously negative for JAK2, MPL, and CALR mutations by PCR-based assays, we identified MPLW515K/L mutations below the detection limit of DARMS-PCR as well as other MPL mutations (MPLW515R). Collectively, the W515K/L/R mutation was identified in 7 (6.3%) ET and 1 (4.3%) PMF patients MPL (Figure 1A, Table 1), which was similar to the frequencies of 3-8.3% that were found in Caucasian cohorts2, 3, 5-7, 10-13 but different from those in a Chinese cohort with a substantially lower frequency (1.2%)4. We noted that one ET patient exhibited both the W515K (allele frequency 50.7%) and W515L (allele MPL frequency 2.5%) mutations. The CALR mutation on exon 9 was examined using our in-house fragment analysis method (see supplemental data). All identified CALR mutations were confirmed by deep sequencing. CALR mutations were identified in 22 (19.6%) ET and 7 (30.4%) PMF patients (Figure 1A), which was similar to the reported frequency in ET (15.5 to 28%)2-6 and PMF (25%) patients7. In contrast, one study examined a Cyprus cohort and identified a frequency of 8.7%10, but patients with thrombocytosis were not classified according to the WHO 2008 criteria. Unlike the MPL mutation, the CALR mutation was present at similar frequencies in ET patients in both Japanese (19.6%) and Chinese (22.7%)4 cohorts. CALR mutations (n=29) were present in the following distribution: 11 type 1 (c.1092_1143del), 8 type 2 (c.1154_1155insTTGTC), 1 type 4 (c.1102_1135del), 1 type 22 (c.1120_1123del), 1 type 28 (c.1131_1152del), 2 type 33 (c.1154_1155insATGTC), and 1 type 34 (c.1154delinsCTTGTC) mutation, as well as four novel mutations c.1153_1154insTCTGT, (type and 42-45; c.1110_1133del, c.1146_1147del;1153_1154del) c.1126_1144del, (summarized in supplemental Table 2). The CALR mutation in PMF patients is limited to types 1 and 2, and the type 1 mutation (n=6) is more frequent than the type 2 mutation (n=1), as observed in a Caucasian PMF cohort3. All novel CALR mutations generate a frame shift that converts the C-terminal amino acids from negatively to positively charged, as is the case for other mutations (supplemental Table 2). Although , JAK2 , and MPL CALR mutations have been proposed to be mutually exclusive, we identified 1 ET patient with JAK2 mutations and 1 ET patient with CALR V617F and JAK2 V617F and W515L MPL mutations, which was consistent with recent reports that described a rare concomitant mutation of these gene mutations in Caucasian7, 14 and Chinese4 cohorts. Finally, patient specimens that were negative for V617F, JAK2 W515K/L, and MPL CALR exon 9 mutations by PCR-based assays were analyzed by deep sequencing of all the JAK2, MPL, and CALR exons (see supplemental data). This analysis identified 22 (19.6%) ET and 4 (17.4%) PMF “triple-negative” patients (Figure 1A). We compared the hematological and clinical features of patients who were classified according to mutation status (Table 1), with the exception of 2 ET patients who harbored concurrent JAK2 and MPL or CALR mutations (see above). In the ET patients, compared with the JAK2V617F mutation, the presence of the CALR or MPL mutation was associated with lower leukocyte and higher platelet counts (Table 1). The CALR mutation was also associated with a lower red blood cell count. These hematological features are consistent with the features reported for different ethnic groups2-5. We observed a trend of male dominance among the ET patients with CALR mutations (male/female=13/8) compared with the patients with JAK2 mutations (male/female=24/35), which is consistent with findings in Caucasian cohorts but inconsistent with findings in a Chinese cohort4. We determined that the triple-negative ET patients (mean age 45.0 years old) were strikingly younger than the patients with other genotypes (Table 1, Figure 1B). Adjusted p-values for multiple comparisons of ages between triple-negative and other genotypes such as mutated , , or JAK2 CALR MPL by Tukey-Kramer test were <0.001, 0.015, and 0.037, respectively. The mean age of the triple-negative ET patients exhibited a wide variation between the cohorts, ranging from 42 to 53 years old3-5. The difference in age between the triple-negative patients and patients with other genotypes was more than 14 years, which was uniquely observed in our cohort. In other cohorts, the difference in the ages of the triple-negative patients with the youngest age and patients with other genotypes with the second youngest age was, at most, 5 years15. Despite a lack of known clonal gene mutations, the triple-negative patients’ bone marrow biopsies indicated apparent proliferation of megakaryocytes with a large and mature morphology, and their clinical characteristics corresponded to the WHO 2008 criteria for ET. Although it was a small cohort, we observed a very similar phenomenon in PMF patients; the difference in the ages of the triple-negative patients and patients with other genotypes was more than 10 years (Table 1). Patients exhibiting myelofibrosis with no clonal mutations (“triple-negative”) were diagnosed as PMF by excluding other diseases such as myelodysplasia through confirming no dysplasia in erythroid and/or myeloid lineages on bone marrow biopsy, chronic myeloid leukemia through defining Bcr-Abl negativity by FISH or PCR, and other diseases including autoimmune disorders through examining clinical records. This finding suggests that triple-negative ET and PMF patients in Japan have a distinct genetic background that facilitates the acceleration of disease onset compared with the Caucasian population. In summary, we have shown that the mutation profile of our Japanese cohort of ET and PMF patients is comparable to that of Caucasian cohorts; however, the frequency of the MPL mutation differs between Asian populations, as demonstrated by the differences found between our cohort and a Chinese cohort. We identified four novel CALR mutations, all of which generate an altered C-terminus sequence that is commonly observed in patients with other CALR mutations, which implies that they are genuine mutations. The triple-negative ET and PMF patients were significantly younger than the patients with other genotypes in our cohort. The magnitude of this difference in Japan is much larger than that in other cohorts, which implies the presence of ethnic differences in ET and PMF development in triple-negative cases. Further genetic analysis would aid in elucidating the genetic factors associated with ET development other than , JAK2 , and CALR mutations. MPL Acknowledgments We thank Kazuhiko Ikeda (Fukushima Medical University), Nobuyoshi Hanaoka (Wakayama Medical University), Toshiro Kurokawa (Toyama Red Cross Hospital), Hideo Harigae (Tohoku University), Takayuki Ikezoe (Kochi University), Jun Murakami (University of Toyama), Kensuke Usuki (NTT Kanto Medical Center), Keita Kirito (University of Yamanashi), and Takao Hirano (Juntendo Nerima Hospital) for providing patient specimens and clinical information. We also thank Joe Matsuoka (Clinical Research Support Center, Juntendo University Graduate School of Medicine); Satoshi Tsuneda and Yuji Sekiguchi for their generous support and encouragement; Kyoko Kubo, Kazuko Kawamura, Junko Enomoto, and Megumi Hasegawa for providing secretarial assistance; and other members of the Department of Hematology for providing support in this study. We also acknowledge the Laboratory of Molecular and Biochemical Research, Research Support Center, Juntendo University Graduate School of Medicine. Funding This work was funded in part by JSPS (http://www.jsps.go.jp/english/e-grants/) KAKENHI grant #25860416 (SM). The funders had no role in the study design, data collection and analysis, decision to publish, or preparation of the manuscript. Competing Interests The authors declare no competing interests. Author Contributions Conceived and designed the experiments: SS, MA, SM, YE, and NK. Performed the experiments: SS, MA, SM, YE, HT, YS, and YH. Analyzed the data: SS, SM, YE, HT, YY, and MC. Contributed reagents/materials/analysis tools: MN, MK, NN, AO, and NK. Wrote the manuscript: SS, MA, SM, and NK. References 1. Cazzola M, Kralovics R. From Janus kinase 2 to calreticulin: the clinically relevant genomic landscape of myeloproliferative neoplasms. Blood. 2014;123(24):3714-9. 2. Rumi E, Pietra D, Ferretti V, Klampfl T, Harutyunyan AS, Milosevic JD, et al. JAK2 or CALR mutation status defines subtypes of essential thrombocythemia with substantially different clinical course and outcomes. Blood. 2014;123(10):1544-51. 3. Tefferi A, Lasho TL, Finke C, Belachew AA, Wassie EA, Ketterling RP, et al. Type 1 vs type 2 calreticulin mutations in primary myelofibrosis: differences in phenotype and prognostic impact. Leukemia. 2014 ;28(7):1568-70. 4. Fu R, Xuan M, Zhou Y, Sun T, Bai J, Cao Z, et al. Analysis of calreticulin mutations in Chinese patients with essential thrombocythemia: clinical implications in diagnosis, prognosis and treatment. Leukemia. 2014;28(9):1912-4. 5. Rotunno G, Mannarelli C, Guglielmelli P, Pacilli A, Pancrazzi A, Pieri L, et al. Impact of calreticulin mutations on clinical and hematological phenotype and outcome in essential thrombocythemia. Blood. 2014;123(10):1552-5. 6. Klampfl T, Gisslinger H, Harutyunyan AS, Nivarthi H, Rumi E, Milosevic JD, et al. Somatic mutations of calreticulin in myeloproliferative neoplasms. The New England journal of medicine. 2013; 369(25):2379-90. 7. Tefferi A, Lasho TL, Finke CM, Knudson RA, Ketterling R, Hanson CH, et al. CALR vs JAK2 vs MPL-mutated or triple-negative myelofibrosis: clinical, cytogenetic and molecular comparisons. Leukemia. 2014 ;28(7):1472-7. 8. Edahiro Y, Morishita S, Takahashi K, Hironaka Y, Yahata Y, Sunami Y, et al. JAK2V617F mutation status and allele burden in classical Ph-negative myeloproliferative neoplasms in Japan. International journal of hematology. 2014;99(5):625-34. 9. Takei H, Morishita S, Araki M, Edahiro Y, Sunami Y, Hironaka Y, et al. Detection of MPLW515L/K mutations and determination of allele frequencies with a single-tube PCR assay. PloS one. 2014;9(8):e104958. 10. Chi J, Nicolaou KA, Nicolaidou V, Koumas L, Mitsidou A, Pierides C, et al. Calreticulin gene exon 9 frameshift mutations in patients with thrombocytosis. Leukemia. 2014;28(5):1152-4. 11. Pardanani AD, Levine RL, Lasho T, Pikman Y, Mesa RA, Wadleigh M, et al. MPL515 mutations in myeloproliferative and other myeloid disorders: a study of 1182 patients. Blood. 2006;108(10):3472-6. 12. Rumi E, Pietra D, Guglielmelli P, Bordoni R, Casetti I, Milanesi C, et al. Acquired copy-neutral loss of heterozygosity of chromosome 1p as a molecular event associated with marrow fibrosis in MPL-mutated myeloproliferative neoplasms. Blood. 2013;121(21):4388-95. 13. Guglielmelli P, Pancrazzi A, Bergamaschi G, Rosti V, Villani L, Antonioli E, et al. Anaemia characterises patients with myelofibrosis harbouring Mpl mutation. British journal of haematology. 2007;137(3):244-7. 14. Lundberg P, Karow A, Nienhold R, Looser R, Hao-Shen H, Nissen I, et al. Clonal evolution and clinical correlates of somatic mutations in myeloproliferative neoplasms. Blood. 2014;123(14):2220-8. 15. Tefferi A, Wassie EA, Guglielmelli P, Gangat N, Belachew AA, Lasho TL, et al. Type 1 versus Type 2 calreticulin mutations in essential thrombocythemia: A collaborative study of 1027 patients. American journal of hematology. 2014;89(8):E121-4. Table 1: Clinical and hematological characteristics according to gene mutation status ET (n=110**) Mutation Number of patients (N) Male:Female (N) Age (years) WBC (×10⁹/L) RBC (×10⁹/L) Hct (%) Hb (g/dL) MCV (fL) Platelets (×10⁹/L) Thrombotic event* Splenomegaly* JAK2 59 (A) 24:35 60.2 (19-83) 11.1 (5.2-52.3) 4783 (3420-7060 ) 42.0 (25.4-54.1) 13.7 (7.9-16.9) 88.6 (66.1-106.6) 890 (486-1580) 9/55 (16.4%) 8/59 (13.6%) (C) negative (D) 22 13:8 59.0 (33-86) 7.9 (4.1-12.7) 4421 (2590-5570) 2:6 62.0 (32-81) 8.2 (4.9-11.3) 4364 (3600-4600) 9:13 45.0 (26-81) 9.6 (4.8-21.9) 4615 (3670-6160) 41.3 (27.6-49.6) 13.6 (9.4-17.0) 93.7 (87.4-115.4) 1109 (496-2832) 1/19 (5.3%) 0/20 (0%) 39.6 (34.3-44.6) 12.7 (10.8-14.1) 90.8 (85.5-97.8) 1177 (800-1592) 1/8 (12.5%) 1/8 (12.5%) 40.9 (33.8-50.0) 13.4 (10.8-16.8) 89.3 (61.7-97.0) 910 (349-2337) 3/19 (15.8%) 1/20 (5.0%) CALR 21 (B) PMF (n=23) MPL 8 JAK2 CALR MPL 11 7 1 7:4 71.9 (52-88) 14.8 (2.2-52.8) 3876 (2230-5760 ) 32.8 (20.4-40.5) 10.3 (6.6-13.0) 86.2 (60.8-98.4) 430 (70-1280) 2/6 (33.3%) 9/11 (81.8%) 5:2 63.6 (55-81) 7.2 (3.2-12.3) 3236 (2200-4111) 1:0 77 29.2 (19.4-38.7) 9.1 (5.7-12.7) 90.2 (83.5-98.5) 477 (82-1491) 0/5 (0%) 4/6 (66.7%) 24.8 4.9 2960 7.8 83.8 351 0/1 (0%) 1/1 (100%) negative 4 2:2 53.3 (38-76) 16.4 (5.4-44.1) 3105 (1920-3680) 28.1 (17.5-34.0) 9.4 (6.1-11.5) 90.7 (87.0-92.4) 264 (2-855) 0/2 (0%) 3/4 (75%) WBC, white blood cell count; RBC, red blood cell count; Hct, hematocrit; Hb, hemoglobin; MCV, mean corpuscular volume. Values with a range are indicated by median values. *A subset of patients was evaluated. **The patients who exhibited mutations in two different genes were omitted. Figure Legends Figure 1. The patients. , JAK2 , and MPL CALR mutation frequencies in ET and PMF (A) The JAK2, MPL, and CALR mutation frequencies in ET (n=112) and PMF (n=23) patients are shown. (B) The mutation statuses of different age groups are shown. JAK2, CALR, and MPL mutation spectrum in Japanese myeloproliferative neoplasms patients. Shirane, et al Supplemental data Materials and Methods Mutation analysis The JAK2V617F mutation profile was first obtained in a previous study1. The patient specimens that exhibited a JAK2V617F mutant allele frequency below 10% in the previous study were re-‐evaluated via deep sequencing (see below). The MPLW515K/L mutation was assessed using a newly developed allele-‐specific polymerase chain reaction (PCR), called dual amplification refractory mutation system PCR (DARMS-‐PCR), and a subsequent capillary electrophoresis method using ABI3130xl (Life Technologies, Carlsbad, USA)2. The CALR mutation on exon 9 was examined using our in-‐house fragment analysis method. The CALR fragment including exon 9 was PCR-‐amplified from 20 ng of genomic DNA using Titanium Taq (TOYOBO, Osaka, Japan) with a FAM (5-‐carboxyfluorescein hydrate)-‐labeled forward primer (TGGTCCTGGTCCTGATGTC) and a reverse primer (GTGGATTTTGGTTTTGTTCC). The PCR conditions were as follows: an initial denaturation at 94°C for 3 min; 30 cycles of denaturation at 95°C for 30 sec, annealing at 68.5°C for 30 sec, extension at 72°C for 30 sec; and a final extension at 72°C for 2 min. The PCR products were diluted with formamide and then analyzed using an ABI3730 DNA Analyzer (Life Technologies) and Gene mapper 4.0 (Life Technologies). Deep-‐sequencing analysis The patient specimens that exhibited a JAK2V617F mutation rate of <10%, were positive for MPLW515K/L, or were positive for a CALR mutation were subjected to deep-‐sequencing analysis. According to the identified mutation, we PCR-‐amplified JAK2 exons 12 and 14, MPL exon 10, or CALR exons 1-‐9 from genomic DNA using KOD plus Neo (TOYOBO); the primers are listed in supplemental Table 1. The specimens were negative for JAK2V617F, MPLW515K/L, and CALR exon 9 mutations based on the previously described PCR-‐based assays; 1 JAK2, CALR, and MPL mutation spectrum in Japanese myeloproliferative neoplasms patients. Shirane, et al follow-‐up analyses were conducted by deep sequencing all exons of the three genes. PCR-‐amplified fragments were purified using an Agencourt AMPure XP kit (Beckman Coulter), and the concentration of each aliquot was subsequently measured using a Quantus fluorometer (Promega, Madison, US). The purified amplicons were mixed together in an equal molecular ratio and were then fragmented to approximately 200 bp using a M220 Forced-‐ultrasonicator (Covaris, Woburn, USA). The sample library was prepared using TruSeq DNA LT Sample prep kits Sets A and B (Illumina, San Diego, USA) according to the manufacturer’s instructions. The libraries were deep-‐sequenced using a MiSeq bench-‐top sequencer (Illumina). For the identification of the JAK2, MPL, and CALR mutations, the data were analyzed using CLC Genomics Workbench software version 6.5 (CLC Bio, Aarhus, Denmark). In addition, an alternative algorithm was used for the identification of CALR mutations. Sequence reads were mapped to the reference genome (hg19) using the BWA program3. Reads containing over 5 uncalled bases and unmapped reads were discarded from subsequent analyses. From the reads aligned to the CALR region, CIGAR strings from the reads in SAM/BAM format were parsed to call potential insertions or deletions using perl scripts. Although mutation calls were not always consistent between two algorithms, at least one algorithm produced mutation calls that matched fragment analysis data. Conversely, deep-‐sequencing analysis revealed low-‐frequency CALR mutations in some specimens, whereas no mutations were detected using fragment analysis. In this case, we determined that no CALR mutations were present based on the fragment analysis data. Statistical analysis Adjusted p-‐values for multiple comparisons of laboratory parameters between patient groups with different mutations were determined by Tukey-‐Kramer test with R3.1.1 (Free Software Foundation, Boston, USA). p-‐values below 0.05 were considered significant. 2 JAK2, CALR, and MPL mutation spectrum in Japanese myeloproliferative neoplasms patients. Shirane, et al References 1. Edahiro Y, Morishita S, Takahashi K, Hironaka Y, Yahata Y, Sunami Y, et al. JAK2V617F mutation status and allele burden in classical Ph-‐negative myeloproliferative neoplasms in Japan. International journal of hematology. 2014 May;99(5):625-‐34. 2. Takei H, Morishita S, Araki M, Edahiro Y, Sunami Y, Hironaka Y, et al. Detection of MPLW515L/K mutations and determination of allele frequencies with a single-‐tube PCR assay. PloS one. 2014;9(8):e104958. 3. Li H, Durbin R. Fast and accurate short read alignment with Burrows-‐Wheeler transform. Bioinformatics. 2009 Jul 15;25(14):1754-‐60. 4. Klampfl T, Gisslinger H, Harutyunyan AS, Nivarthi H, Rumi E, Milosevic JD, et al. Somatic mutations of calreticulin in myeloproliferative neoplasms. The New England journal of medicine. 2013 Dec 19;369(25):2379-‐90. 3 forward GAAGTGGGAGTGGTGTGGG CCCCTGGATTTATGTGGTAGTAG CCAGCCCATTTGTAACTTTATTG CGACTGCTATTACATTTTGTTCC CGTTTGTATTTGAACTATTTGGAAGC TGGCCAATTTGTATCTTGTAAATG TGTATGTGCTTTTTTATCCCTAGC AATGGCTCTGTAAATTCTACCCG TAATTCATATTGAGTACTGAGCCA TGATTGTTTTAGATGACACTTGGTC GATGTCCATTGTGACTATCCCTC TGGAGCAATTCATACTTTCAGTG TCCTACTTCGTTCTCCATCTTTAC GAGAAAGTGCATCTTTATTATGGC TTGTTTAGACTCCTACTCTTGCTG TTCTTCTTTAAATCTGTTTTGGGG TTGGTTTACTTGTGAATTATTTAACCC AAGAAGGTTGGTGTGGCATTAC TTTTGGTCAACTTGAATGTATATCAG JAK2 exon 1 JAK2 exon 2 JAK2 exon 3 JAK2 exon 4 JAK2 exon 5 JAK2 exon 6 JAK2 exon 7 JAK2 exon 8 JAK2 exon 9 4 JAK2 exon 10 JAK2 exon 11 JAK2 exon 12 JAK2 exon 13 JAK2 exon 14 JAK2 exon 15 JAK2 exon 16 JAK2 exon 17 JAK2 exon 18 JAK2 exon 19 CAAGCACTCCTTAAAATGTTGTAG CCCAAATGACATCAAGAAAATG CCTTCTTTTTAAAATTAGATGGGC TTTACACCACTGCCCAAGTAAAG TTTGTTTCCAGGTAAAGATAATTTG TACACTGACACCTAGCTGTGATCC TCTTTAAACAGCATAAACTACATGAAC AACACAAGGTTGGCATATTTTTC TACTTCACGCCACATAAACAATC TTTGTACAGAATCTCTGAGGAAATTAAG CAGCATTTACTTTTCTAAAAATTTACTT TTTAAAACTACAATCAAAATTCCTACC CTTTGTTTTTATTTCCATTGTACTTA TCACACTTATGTGTAAGGATTTGC CAAGACAGAACTGCAATTTTCC TTTGCCTTTTAGCATTAAGTGAG AAAACAATCCATGCATAAAAAGG CAGCGATAAAGGACAGCACAC AAGCCAGGCAGAGATAACACC reverse !"##$%&%'()$*+),$%*-.*/01&%02*"2%3*450*%65'*)&#$1417)(15'8* target ! ! ! JAK2, CALR, and MPL mutation spectrum in Japanese myeloproliferative neoplasms patients. Shirane, et al TGCAGGATTTGGGTCAAACAG CGAAGTCTGACCCTTTTTGTCT CCTGCCAATCCACTGCCA TGGTCCTGGTCCTGATGTC MPL exon 9 MPL exon 10 MPL exon 11–12 CALR exon 9 TGCAGCAGGTTAAGAATTTTTTC AGGCCTGATTCAATGACTCT TGGTGAATGTGTTTTTTAAATGG MPL exon 7–8 TTTCACATAAAGGGAACAAATGTC GTTGGAGGCTCTCTCAGCTG CCTTCAACCCAAAATCAGAAGTC TTTCAACTCAGCTTTTTGAGACC MPL exon 5–6 CAAAACCCACCATATTTTATTTTAGC TTCTGAGACCAAAGTAGATTTACAGAAC GTGGTACTCAGAGTTCTGATGTG TTTATGGCTTAAGCTTAAATTTAGT GCCCTTAGTGTTCATTTAATTTTG JAK2 exon 25 MPL exon 4 CCACAAATAGATACAAGGGAAACC TTGACTGGAGGAAATTGAGAAAG JAK2 exon 24 CTGTATCTGACAGGAACCTGAGG GCGATATAAATGAACAAGGACAC TTTGCAGGTAAAATCAAGAGTCC JAK2 exon 23 MPL exon 1–3 TTTTCAGGTCTCAAAAAGCTGAG AATAAAGGGAATATATAGGGTTAAGACC JAK2 exon 22 5 ! ! ! ! GGAACAAAACCAAAATCCAC TTACCTTAATCCCATGCCAGC GGTCACAGAGCGAACCAAGA GGCTTGCCTCACCGGTCT TGAGGTCTGTGGGCATTTGTTG AACCTCAATCAGCAGTTCAG CAAGATTGAAGGTAGGAGATAAGA GTGACAGGAGGATGGCTCT CAGGAAGTGAACTGAAGTCCTTG GGTGGATACCCTAAAAGCTCTG CAATAAAGTTTGAAGTCTGTGCTC TTCCTAATGTCTACTTCAACACGG GCAGAGTAAAACATTATTTCCACC JAK2 exon 21 TTTAAAATAGGTTTCAATGGGCAG CTTGAAAACTTGGTATTTCCATCC JAK2 exon 20 JAK2, CALR, and MPL mutation spectrum in Japanese myeloproliferative neoplasms patients. Shirane, et al 6 c.1153_1154insTCTGT c.1146_1147del;1153_1154del 44 45 * types 1, 2, 4, 22, 28, 33, 344 Total c.1126_1144del 43 c.1131_1152del 28 c.1110_1133del c.1120_1123del 22 42 c.1102_1135del 4 c.1154delinsCTTGTC c.1154_1155insTTGTC 2 34 c.1092_1143del 1 c.1154_1155insATGTC wild type – 33 Nucleotide Type 11 (5/6) 24 (20/4) (ET/PMF) Pts. 1 (1/0) 1 (1/0) 1 (1/0) 1 (1/0) 1 (1/0) AAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAGRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- 53 (42/11) 1 (1/0) AAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDICRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- 1 (1/0) AAEKQMKDKQDEEQRLKEEEEDKKQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- AAEKQMKDKQDEEQRRRRRQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- AAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDTCRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- 1 (1/0) AAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDCRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- 2 (2/0) AAEKQMKDKQDEEQRLKEEEEDKKRKRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- AAEKQMKDKQDEEQRLKEEEEDNAKRRRRQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- AAEKQMKDKQDEEQRLRRRQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- AAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDNCRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- 8 (7/1) AAEKQMKDKQDEEQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA- AAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL- Amino Acid * !"##$%&%'()$*+),$%*9.*:12(*54*!"#$*&"()(15'2*13%'(141%3*1'*(;%*#0%2%'(*2("3<* 100 1.9 1.9 1.9 1.9 1.9 3.8 1.9 1.9 1.9 15.1 20.8 45.3 % JAK2, CALR, and MPL mutation spectrum in Japanese myeloproliferative neoplasms patients. Shirane, et al
© Copyright 2026 ExpyDoc